Project name: 1016ed1d395ee31

Status: done

submitted: 2017-11-14 10:16:03, status changed: 2017-11-14 11:42:52
Settings
Chain sequence(s) A: DIVMTQSPLSVPVTPGEPVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLICIIWLAFVGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGPGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIVMTQSPLSVPVTPGEPVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLICIIWLAFVGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGPGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVQSGAEVKKPGETVKISCKASDYTFTYYGMNWVKQAPGQGLKWMGWIDTTTGEPTYAQKFQGRIAFSLETSASTAYLQIKSLKSEDTATYFCARRGPYNWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVQSGAEVKKPGETVKISCKASDYTFTYYGMNWVKQAPGQGLKWMGWIDTTTGEPTYAQKFQGRIAFSLETSASTAYLQIKSLKSEDTATYFCARRGPYNWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.5148
Maximal score value
2.5547
Average score
-0.7924
Total score value
-1058.6981

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.4702
2 I A 0.6150
3 V A 0.0000
4 M A -0.0684
5 T A 0.0000
6 Q A -1.3473
7 S A -0.4174
8 P A 0.0159
9 L A 0.9476
10 S A 0.0030
11 V A -0.2056
12 P A -0.6172
13 V A 0.0000
14 T A -1.6672
15 P A -1.8718
16 G A -2.0102
17 E A -2.0280
18 P A -1.8991
19 V A 0.0000
20 S A -1.2529
21 I A 0.0000
22 S A -1.1715
23 C A 0.0000
24 R A -1.9136
25 S A 0.0000
26 S A -1.0788
27 K A -2.1303
28 S A -1.5806
29 L A 0.0000
30 L A -1.0434
31 H A -2.1001
32 S A -1.4568
33 N A -2.0441
34 G A -1.6571
35 N A -1.1688
36 T A 0.0000
37 Y A 0.0000
38 L A 0.0000
39 Y A 0.0000
40 W A 0.0000
41 F A 0.0000
42 L A 0.0000
43 Q A -1.6754
44 R A -2.8702
45 P A -2.2055
46 G A -1.8067
47 Q A -2.4738
48 S A -1.7509
49 P A 0.0000
50 Q A -1.3550
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 C A 1.1859
55 I A 1.2966
56 I A 1.1354
57 W A 1.7819
58 L A 2.5547
59 A A 1.5432
60 F A 1.8530
61 V A 2.1025
62 G A 0.4787
63 V A 0.4359
64 P A -0.8729
65 D A -1.9363
66 R A -1.9556
67 F A 0.0000
68 S A 0.0000
69 G A 0.0000
70 S A 0.0222
71 G A -0.2265
72 S A -0.5446
73 G A 0.0000
74 T A -1.1037
75 A A -0.9744
76 F A 0.0000
77 T A -0.8816
78 L A 0.0000
79 R A -2.1124
80 I A 0.0000
81 S A -2.2627
82 R A -2.9581
83 V A 0.0000
84 E A -2.0593
85 A A -1.6588
86 E A -2.2941
87 D A 0.0000
88 V A -1.3283
89 G A 0.0000
90 V A -0.6297
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 L A 0.0000
95 Q A 0.0000
96 H A -0.7805
97 L A -1.2976
98 E A -2.0015
99 Y A -0.7018
100 P A -0.6707
101 F A 0.0000
102 T A -0.3240
103 F A 0.0000
104 G A 0.0000
105 P A -0.3678
106 G A -0.5635
107 T A 0.0000
108 K A -0.9938
109 L A 0.0000
110 E A -0.9645
111 L A 0.0000
112 K A -1.5150
113 R A -1.8529
114 T A -0.2331
115 V A 0.9501
116 A A 0.3328
117 A A 0.1232
118 P A -0.1795
119 S A -0.2855
120 V A 0.0000
121 F A 0.1521
122 I A 0.0000
123 F A 0.0000
124 P A -0.4148
125 P A 0.0000
126 S A -1.8838
127 D A -3.2646
128 E A -3.2250
129 Q A 0.0000
130 L A -2.0848
131 K A -2.8999
132 S A -1.7456
133 G A -1.1104
134 T A -0.7633
135 A A 0.0000
136 S A 0.0000
137 V A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 L A 0.0000
142 N A 0.0000
143 N A -0.8348
144 F A 0.0000
145 Y A 0.0000
146 P A -1.7611
147 R A -3.2039
148 E A -3.3171
149 A A -2.5351
150 K A -2.5041
151 V A -1.3130
152 Q A -1.0018
153 W A 0.0000
154 K A -0.6571
155 V A -0.8857
156 D A -1.5223
157 N A -1.2870
158 A A -0.3396
159 L A 0.3647
160 Q A -1.0391
161 S A -0.9097
162 G A -1.3116
163 N A -1.9667
164 S A -1.5757
165 Q A -1.2885
166 E A -1.8328
167 S A 0.0000
168 V A -0.6598
169 T A -1.1113
170 E A -2.3331
171 Q A 0.0000
172 D A -2.4724
173 S A -2.2279
174 K A -2.4195
175 D A -2.2335
176 S A 0.0000
177 T A -1.7782
178 Y A 0.0000
179 S A 0.0000
180 L A 0.0000
181 S A 0.0000
182 S A 0.0000
183 T A -0.7105
184 L A 0.0000
185 T A -0.4843
186 L A -0.6628
187 S A -1.0465
188 K A -1.5293
189 A A -1.7507
190 D A -2.6304
191 Y A 0.0000
192 E A -2.4315
193 K A -3.2371
194 H A -2.6790
195 K A -2.6708
196 V A -1.2890
197 Y A 0.0000
198 A A -0.8830
199 C A 0.0000
200 E A -1.0999
201 V A 0.0000
202 T A -1.1603
203 H A 0.0000
204 Q A -1.7564
205 G A -0.3664
206 L A -0.0341
207 S A -0.3841
208 S A -0.3149
209 P A -0.5717
210 V A -0.0543
211 T A -0.5217
212 K A -0.7864
213 S A -0.6486
214 F A -0.9492
215 N A -1.5624
216 R A -1.9512
217 G A -1.5757
218 E A -2.0725
219 C A -1.7577
220 Q B -1.7568
221 V B -1.6841
222 Q B -1.9998
223 L B 0.0000
224 V B -0.3443
225 Q B -0.5502
226 S B -0.9879
227 G B -1.1532
228 A B 0.0000
229 E B -1.9811
230 V B -1.0045
231 K B -1.7017
232 K B -2.1816
233 P B -2.2341
234 G B -2.2466
235 E B -2.6547
236 T B -2.3548
237 V B -1.8088
238 K B -2.1405
239 I B 0.0000
240 S B -0.8350
241 C B 0.0000
242 K B -1.4577
243 A B 0.0000
244 S B -1.6318
245 D B -2.2394
246 Y B -0.7206
247 T B 0.1426
248 F B 0.0000
249 T B 0.5713
250 Y B 1.5108
251 Y B 0.7158
252 G B 0.0000
253 M B 0.0000
254 N B 0.0000
255 W B 0.0000
256 V B 0.0000
257 K B 0.0000
258 Q B -1.0142
259 A B -1.2020
260 P B -0.9714
261 G B -1.2573
262 Q B -1.8214
263 G B -1.2141
264 L B 0.0000
265 K B -1.3738
266 W B 0.0000
267 M B 0.0000
268 G B 0.0000
269 W B 0.0000
270 I B 0.0000
271 D B -0.8239
272 T B -0.0543
273 T B -0.3597
274 T B -1.0496
275 G B -1.5183
276 E B -2.1676
277 P B -1.1484
278 T B -0.5154
279 Y B -0.6704
280 A B -1.3426
281 Q B -2.6520
282 K B -3.3294
283 F B 0.0000
284 Q B -2.8166
285 G B -2.4670
286 R B -3.5355
287 I B 0.0000
288 A B -1.1842
289 F B 0.0000
290 S B -0.2024
291 L B -0.2773
292 E B -1.0055
293 T B -0.3065
294 S B -0.4668
295 A B -0.5520
296 S B -0.7244
297 T B 0.0000
298 A B 0.0000
299 Y B -0.4626
300 L B 0.0000
301 Q B -1.6411
302 I B 0.0000
303 K B -3.2402
304 S B -2.3937
305 L B 0.0000
306 K B -2.9074
307 S B -2.0243
308 E B -2.5272
309 D B 0.0000
310 T B -1.0959
311 A B 0.0000
312 T B -0.5507
313 Y B 0.0000
314 F B 0.0000
315 C B 0.0000
316 A B 0.0000
317 R B -0.7891
318 R B -1.3574
319 G B -0.8425
320 P B -0.3949
321 Y B -0.4974
322 N B 0.0000
323 W B 0.0000
324 Y B 0.0000
325 F B 0.0000
326 D B -0.7198
327 V B 0.0000
328 W B 0.0000
329 G B 0.0000
330 Q B -1.4609
331 G B -0.8191
332 T B -0.7564
333 T B -0.8511
334 V B 0.0000
335 T B -0.9914
336 V B 0.0000
337 S B -1.0638
338 S B -0.8379
339 A B -0.7117
340 S B -0.9654
341 T B -1.2152
342 K B -2.1175
343 G B -1.7565
344 P B -0.8774
345 S B -0.6628
346 V B 0.0000
347 F B 0.0000
348 P B -1.4452
349 L B 0.0000
350 A B -0.9776
351 P B -0.7722
352 S B -1.1323
353 S B -1.4728
354 K B -1.8348
355 S B -1.4334
356 T B -0.9582
357 S B -0.9620
358 G B -0.7735
359 G B -0.7024
360 T B -0.5212
361 A B 0.0000
362 A B 0.0000
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.4321
369 D B -0.8325
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -1.0269
374 P B -0.8334
375 V B -0.8087
376 T B -0.5415
377 V B -0.2850
378 S B -0.2757
379 W B 0.0000
380 N B -0.8004
381 S B -0.6253
382 G B -0.3410
383 A B -0.1304
384 L B 0.1489
385 T B -0.0288
386 S B -0.0555
387 G B -0.0478
388 V B 0.4034
389 H B -0.1343
390 T B 0.0713
391 F B 0.0000
392 P B -0.2837
393 A B 0.3276
394 V B 0.4644
395 L B 0.7884
396 Q B -0.2697
397 S B -0.2246
398 S B -0.0936
399 G B -0.5507
400 L B -0.1790
401 Y B -0.0269
402 S B 0.0000
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0391
409 V B 0.0000
410 P B -0.5173
411 S B -0.6106
412 S B -0.6861
413 S B -0.7918
414 L B -0.9114
415 G B -1.1461
416 T B -0.9208
417 Q B -1.3930
418 T B -1.3478
419 Y B 0.0000
420 I B -1.4374
421 C B 0.0000
422 N B -1.5092
423 V B 0.0000
424 N B -1.9269
425 H B 0.0000
426 K B -2.7053
427 P B -1.8892
428 S B -1.9728
429 N B -2.4807
430 T B -2.0987
431 K B -2.5565
432 V B -1.7230
433 D B -2.6417
434 K B -2.3376
435 K B -2.8151
436 V B 0.0000
437 E B -2.9057
438 P B -2.2077
439 K B -2.8361
440 S B -1.8254
441 C B -1.6527
442 D B -1.8997
443 K B 0.0000
444 T B 0.0000
445 H B -1.6153
446 T B -1.1822
447 C B 0.0000
448 P B -1.0807
449 P B -0.9303
450 C B -0.6739
451 P B -0.7547
452 A B -0.6788
453 P B -0.8687
454 E B -1.1095
455 L B 0.4590
456 L B 1.1893
457 G B 0.1720
458 G B -0.3119
459 P B 0.0000
460 S B -0.1103
461 V B 0.0000
462 F B 1.0779
463 L B 0.0000
464 F B 1.2373
465 P B 0.0089
466 P B 0.0000
467 K B -2.0724
468 P B -1.3408
469 K B -1.2697
470 D B -1.4765
471 T B 0.0000
472 L B 0.0000
473 M B 0.4205
474 I B 1.3981
475 S B -0.0672
476 R B -1.3636
477 T B -0.7622
478 P B 0.0000
479 E B -1.1368
480 V B 0.0000
481 T B 0.5665
482 C B 0.0000
483 V B 0.0000
484 V B 0.0000
485 V B -0.5866
486 D B -1.5526
487 V B 0.0000
488 S B -2.1584
489 H B -2.2203
490 E B -2.9200
491 D B -2.6185
492 P B -2.6508
493 E B -3.2393
494 V B 0.0000
495 K B -2.3149
496 F B 0.0000
497 N B -1.9187
498 W B 0.0000
499 Y B -1.2767
500 V B -0.8844
501 D B -2.0041
502 G B -0.8583
503 V B 0.6523
504 E B -0.9424
505 V B 0.1345
506 H B -1.3043
507 N B -1.3259
508 A B -1.0404
509 K B -2.2930
510 T B 0.0000
511 K B -2.4949
512 P B -2.3494
513 R B -4.1126
514 E B -4.5148
515 E B -3.8717
516 Q B -2.7591
517 Y B -1.4626
518 N B -1.4109
519 S B -1.3775
520 T B -1.8381
521 Y B -2.7717
522 R B -2.6834
523 V B 0.0000
524 V B -1.1690
525 S B 0.0000
526 V B -0.0596
527 L B 0.0000
528 T B -0.1952
529 V B 0.4212
530 L B 1.0741
531 H B -0.0242
532 Q B -0.8890
533 D B -1.0376
534 W B 0.0000
535 L B -0.8013
536 N B -1.9599
537 G B -2.0450
538 K B -2.2783
539 E B -2.4455
540 Y B 0.0000
541 K B -1.8972
542 C B 0.0000
543 K B -1.5879
544 V B 0.0000
545 S B -1.2914
546 N B -1.7467
547 K B -2.0668
548 A B -1.2403
549 L B -0.5337
550 P B -0.3981
551 A B -0.2314
552 P B -0.2953
553 I B -0.1479
554 E B -1.1038
555 K B -1.2211
556 T B -1.1702
557 I B -0.2065
558 S B -1.5883
559 K B -1.3800
560 A B -1.2638
561 K B -2.3160
562 G B -2.0953
563 Q B -2.1668
564 P B -2.2644
565 R B -2.7697
566 E B -2.8024
567 P B 0.0000
568 Q B -1.2561
569 V B 0.0000
570 Y B -0.7903
571 T B 0.0000
572 L B -0.2248
573 P B 0.0153
574 P B -0.6702
575 S B -1.2338
576 R B -2.3821
577 D B -2.5746
578 E B 0.0000
579 L B -0.8442
580 T B -1.4059
581 K B -2.6731
582 N B -2.8231
583 Q B -2.7229
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B 0.0000
592 G B -0.9741
593 F B 0.0000
594 Y B -1.2891
595 P B 0.0000
596 S B -0.0101
597 D B -0.8410
598 I B 0.0000
599 A B -0.5664
600 V B 0.0000
601 E B -1.1031
602 W B 0.0000
603 E B -2.0548
604 S B 0.0000
605 N B -2.1810
606 G B -1.8897
607 Q B -2.3077
608 P B -2.1047
609 E B -2.4325
610 N B -2.1854
611 N B -1.7211
612 Y B -1.0098
613 K B -0.4765
614 T B -0.2890
615 T B 0.0000
616 P B 0.0237
617 P B 0.2579
618 V B 0.6656
619 L B 0.8017
620 D B -0.4191
621 S B -1.3071
622 D B -1.9228
623 G B -0.7607
624 S B 0.0000
625 F B 0.2084
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9659
633 V B 0.0000
634 D B -2.7667
635 K B -2.8974
636 S B -2.5905
637 R B -3.0634
638 W B -2.0312
639 Q B -2.4474
640 Q B -2.6111
641 G B -1.2899
642 N B -1.3084
643 V B -0.3739
644 F B 0.0000
645 S B -1.0336
646 C B 0.0000
647 S B -0.8355
648 V B 0.0000
649 M B -0.7103
650 H B 0.0000
651 E B -1.2206
652 A B -1.9538
653 L B 0.0000
654 H B -1.8731
655 N B -1.7829
656 H B -1.3250
657 Y B -0.8232
658 T B -1.1652
659 Q B -1.3618
660 K B -0.9727
661 S B -0.2647
662 L B 0.5161
663 S B 0.5187
664 L B 1.2460
665 S B 0.3919
666 P B -0.1107
667 G B -0.0574
668 K B 0.0000
669 D C -1.6533
670 I C 0.2725
671 V C 0.0000
672 M C 0.0629
673 T C 0.0000
674 Q C -1.3063
675 S C -0.4879
676 P C -0.0246
677 L C 0.8546
678 S C -0.0992
679 V C -0.3154
680 P C -0.6310
681 V C 0.0000
682 T C -1.6275
683 P C -1.8596
684 G C -2.0608
685 E C -2.1210
686 P C -1.9683
687 V C 0.0000
688 S C -1.3428
689 I C 0.0000
690 S C -1.1331
691 C C 0.0000
692 R C -1.8281
693 S C 0.0000
694 S C -1.1948
695 K C -2.0193
696 S C -1.1455
697 L C 0.0000
698 L C 0.1883
699 H C -0.4191
700 S C -0.9216
701 N C -1.6225
702 G C -1.0225
703 N C -0.5013
704 T C 0.0000
705 Y C 0.5355
706 L C 0.0000
707 Y C 0.0000
708 W C 0.0000
709 F C 0.0000
710 L C 0.0000
711 Q C -0.9696
712 R C -1.4836
713 P C -1.4256
714 G C -1.6142
715 Q C -2.0160
716 S C -1.3594
717 P C 0.0000
718 Q C -0.6497
719 L C 0.0000
720 L C 0.0000
721 I C 0.0000
722 C C 1.2325
723 I C 1.3763
724 I C 1.0474
725 W C 1.7872
726 L C 2.5068
727 A C 1.4969
728 F C 1.8155
729 V C 2.0696
730 G C 0.4092
731 V C 0.3187
732 P C -0.7057
733 D C -1.9501
734 R C -1.8862
735 F C 0.0000
736 S C 0.0000
737 G C 0.0000
738 S C 0.0639
739 G C -0.1461
740 S C -0.5608
741 G C -0.6354
742 T C -1.1450
743 A C -0.9174
744 F C 0.0000
745 T C -0.8972
746 L C 0.0000
747 R C -2.2890
748 I C 0.0000
749 S C -2.3566
750 R C -2.9648
751 V C 0.0000
752 E C -2.3181
753 A C -1.7712
754 E C -2.2149
755 D C 0.0000
756 V C -1.0768
757 G C 0.0000
758 V C -0.4103
759 Y C 0.0000
760 Y C 0.0000
761 C C 0.0000
762 L C 0.0000
763 Q C 0.0000
764 H C 0.0000
765 L C -0.6736
766 E C -1.7872
767 Y C -0.8103
768 P C -0.7677
769 F C 0.0000
770 T C -0.3305
771 F C 0.0000
772 G C 0.0000
773 P C -0.3857
774 G C -0.5293
775 T C 0.0000
776 K C -0.9908
777 L C 0.0000
778 E C -0.9769
779 L C -1.3239
780 K C -1.3973
781 R C -1.3807
782 T C -0.0318
783 V C 0.9141
784 A C 0.3156
785 A C 0.0398
786 P C -0.2508
787 S C -0.3465
788 V C 0.0000
789 F C 0.1086
790 I C 0.0000
791 F C 0.0000
792 P C 0.0000
793 P C 0.0000
794 S C 0.0000
795 D C -2.8411
796 E C -2.6897
797 Q C 0.0000
798 L C -2.0300
799 K C -2.6514
800 S C -1.6293
801 G C -1.1159
802 T C -0.6827
803 A C 0.0000
804 S C 0.0000
805 V C 0.0000
806 V C 0.0000
807 C C 0.0000
808 L C 0.0000
809 L C 0.0000
810 N C 0.0000
811 N C -1.1160
812 F C 0.0000
813 Y C 0.0000
814 P C -1.7762
815 R C -3.1840
816 E C -3.3086
817 A C -2.5036
818 K C -2.4836
819 V C -1.1348
820 Q C -1.0256
821 W C 0.0000
822 K C -0.8260
823 V C 0.0000
824 D C -1.6669
825 N C -1.4186
826 A C -0.4695
827 L C 0.1562
828 Q C -1.1355
829 S C -0.9553
830 G C -1.3149
831 N C -1.8768
832 S C -1.4291
833 Q C -0.9803
834 E C -1.1661
835 S C -0.3122
836 V C -0.5148
837 T C -1.0604
838 E C -2.2952
839 Q C 0.0000
840 D C -2.5228
841 S C -2.4532
842 K C -2.7613
843 D C -2.9231
844 S C -2.4281
845 T C 0.0000
846 Y C 0.0000
847 S C 0.0000
848 L C -0.5170
849 S C 0.0000
850 S C 0.0000
851 T C 0.0000
852 L C 0.0000
853 T C -0.5416
854 L C -0.5419
855 S C -0.9605
856 K C -1.6241
857 A C -1.6623
858 D C -1.9612
859 Y C 0.0000
860 E C -3.2728
861 K C -3.3087
862 H C -2.9881
863 K C -3.2025
864 V C -1.5038
865 Y C 0.0000
866 A C -0.8777
867 C C 0.0000
868 E C -0.9348
869 V C 0.0000
870 T C -1.1575
871 H C 0.0000
872 Q C -1.7822
873 G C -0.4273
874 L C -0.0759
875 S C -0.4174
876 S C -0.3581
877 P C -0.5334
878 V C 0.0049
879 T C -0.4344
880 K C -0.6365
881 S C -0.6304
882 F C 0.0000
883 N C -1.8268
884 R C -2.3931
885 G C -1.5866
886 E C -1.3124
887 C C -0.3658
888 Q D -1.6238
889 V D -1.2632
890 Q D -1.7604
891 L D 0.0000
892 V D -0.4592
893 Q D -0.5989
894 S D -0.9656
895 G D -1.1433
896 A D 0.0000
897 E D -1.5766
898 V D -1.1092
899 K D -1.8539
900 K D -2.6330
901 P D -2.3791
902 G D -2.2463
903 E D -2.7133
904 T D -2.2303
905 V D -1.7977
906 K D -1.9467
907 I D 0.0000
908 S D 0.0000
909 C D 0.0000
910 K D -1.2928
911 A D 0.0000
912 S D -1.4161
913 D D -2.0688
914 Y D -0.6366
915 T D 0.1569
916 F D 0.0000
917 T D 0.4760
918 Y D 1.4347
919 Y D 0.7198
920 G D 0.0000
921 M D 0.0000
922 N D 0.0000
923 W D 0.0000
924 V D 0.0000
925 K D 0.0000
926 Q D -1.0801
927 A D -1.2618
928 P D -0.9945
929 G D -1.2711
930 Q D -1.8550
931 G D -1.2692
932 L D 0.0000
933 K D -1.3223
934 W D 0.0000
935 M D 0.0000
936 G D 0.0000
937 W D 0.0000
938 I D 0.0000
939 D D -0.8908
940 T D -0.0879
941 T D -0.3378
942 T D -1.1043
943 G D -1.5172
944 E D -2.2007
945 P D -1.1802
946 T D -0.5994
947 Y D -0.9141
948 A D -1.2729
949 Q D -2.5584
950 K D -3.1323
951 F D 0.0000
952 Q D -2.7376
953 G D -2.3080
954 R D -3.1686
955 I D 0.0000
956 A D -1.1015
957 F D 0.0000
958 S D -0.3963
959 L D -0.3739
960 E D -1.1362
961 T D -0.4346
962 S D -0.5265
963 A D -0.5833
964 S D -0.7002
965 T D -0.7653
966 A D 0.0000
967 Y D -0.5357
968 L D 0.0000
969 Q D -1.5281
970 I D 0.0000
971 K D -2.6617
972 S D -2.1048
973 L D 0.0000
974 K D -2.8679
975 S D -2.0653
976 E D -2.5514
977 D D -1.7463
978 T D -1.1466
979 A D 0.0000
980 T D -0.5455
981 Y D 0.0000
982 F D 0.0000
983 C D 0.0000
984 A D 0.0000
985 R D 0.0000
986 R D -0.8742
987 G D -0.4642
988 P D -0.1370
989 Y D -0.1108
990 N D 0.0000
991 W D 0.0000
992 Y D 0.0000
993 F D -0.2438
994 D D -0.2268
995 V D -0.2595
996 W D 0.0000
997 G D 0.0000
998 Q D -1.4866
999 G D -0.8805
1000 T D -0.7177
1001 T D -0.7013
1002 V D 0.0000
1003 T D -1.0606
1004 V D 0.0000
1005 S D -1.2556
1006 S D -1.0290
1007 A D -0.8348
1008 S D -1.0571
1009 T D -1.2160
1010 K D -2.0560
1011 G D -1.7631
1012 P D -0.8678
1013 S D -0.4278
1014 V D 0.0000
1015 F D -0.6606
1016 P D 0.0000
1017 L D 0.0000
1018 A D 0.0000
1019 P D 0.0000
1020 S D 0.0000
1021 S D -1.0717
1022 K D -1.9756
1023 S D -1.2326
1024 T D -0.9653
1025 S D -0.8877
1026 G D -0.7724
1027 G D -0.7030
1028 T D -0.5060
1029 A D 0.0000
1030 A D 0.0000
1031 L D 0.0000
1032 G D 0.0000
1033 C D 0.0000
1034 L D 0.0000
1035 V D 0.0000
1036 K D -0.3615
1037 D D -0.7957
1038 Y D 0.0000
1039 F D 0.0000
1040 P D 0.0000
1041 E D -1.0302
1042 P D -1.0050
1043 V D -0.7555
1044 T D -0.6173
1045 V D -0.3278
1046 S D -0.3194
1047 W D 0.0000
1048 N D -0.7694
1049 S D -0.6194
1050 G D -0.3476
1051 A D -0.1663
1052 L D 0.0298
1053 T D -0.0994
1054 S D -0.1146
1055 G D -0.2183
1056 V D 0.2965
1057 H D -0.1334
1058 T D 0.0388
1059 F D 0.0000
1060 P D -0.1590
1061 A D 0.2803
1062 V D 0.8172
1063 L D 1.4269
1064 Q D 0.2666
1065 S D 0.0055
1066 S D -0.3419
1067 G D 0.0092
1068 L D 0.0883
1069 Y D 0.0000
1070 S D 0.0000
1071 L D 0.0000
1072 S D 0.0000
1073 S D 0.0000
1074 V D 0.0000
1075 V D 0.0000
1076 T D -0.0731
1077 V D 0.0000
1078 P D -0.5123
1079 S D -0.5813
1080 S D -0.6578
1081 S D -0.7751
1082 L D -0.9000
1083 G D -1.1493
1084 T D -0.9211
1085 Q D -1.3895
1086 T D -1.2962
1087 Y D 0.0000
1088 I D -1.3137
1089 C D 0.0000
1090 N D -1.5938
1091 V D 0.0000
1092 N D -2.1055
1093 H D 0.0000
1094 K D -2.7703
1095 P D -1.9358
1096 S D -1.9910
1097 N D -2.5542
1098 T D -2.1539
1099 K D -2.6668
1100 V D -1.8345
1101 D D -2.6613
1102 K D -2.2759
1103 K D -2.7397
1104 V D -1.8758
1105 E D -2.5654
1106 P D -1.5218
1107 K D -1.1622
1108 S D -1.1618
1109 C D -0.5346
1110 D D -1.8122
1111 K D -2.1790
1112 T D 0.0000
1113 H D -1.6111
1114 T D -1.5702
1115 C D -1.3250
1116 P D -1.1281
1117 P D -0.8026
1118 C D -0.8099
1119 P D -0.8147
1120 A D 0.0000
1121 P D -0.8709
1122 E D -1.3078
1123 L D 0.0991
1124 L D 1.2515
1125 G D 0.0379
1126 G D -0.2292
1127 P D -0.1467
1128 S D -0.0647
1129 V D 0.0000
1130 F D 0.8653
1131 L D 0.0000
1132 F D 1.3972
1133 P D 0.0882
1134 P D 0.0000
1135 K D -2.1165
1136 P D -1.3880
1137 K D -1.1783
1138 D D -1.3736
1139 T D 0.0000
1140 L D 0.0000
1141 M D 0.4643
1142 I D 1.3930
1143 S D -0.0947
1144 R D -1.4259
1145 T D -0.8460
1146 P D 0.0000
1147 E D -1.3861
1148 V D 0.0000
1149 T D 0.5889
1150 C D 0.0000
1151 V D 0.0000
1152 V D 0.0000
1153 V D -0.0571
1154 D D -0.2267
1155 V D 0.0000
1156 S D -1.6599
1157 H D -2.3158
1158 E D -2.8880
1159 D D -2.3343
1160 P D -2.5315
1161 E D -2.9482
1162 V D 0.0000
1163 K D -2.5306
1164 F D 0.0000
1165 N D -1.4718
1166 W D 0.0000
1167 Y D -0.6890
1168 V D -0.3689
1169 D D -1.2936
1170 G D -0.2737
1171 V D 1.2397
1172 E D 0.1114
1173 V D 0.5916
1174 H D -1.0371
1175 N D -1.0150
1176 A D -1.0252
1177 K D -1.9484
1178 T D -1.2907
1179 K D -1.9381
1180 P D -1.9163
1181 R D -2.8360
1182 E D -2.5902
1183 E D -1.8588
1184 Q D -1.1995
1185 Y D -0.3474
1186 N D -0.6138
1187 S D -0.6237
1188 T D 0.0000
1189 Y D -1.2142
1190 R D -1.4702
1191 V D 0.0000
1192 V D -0.6413
1193 S D 0.0000
1194 V D 0.0019
1195 L D 0.0000
1196 T D -0.4896
1197 V D 0.3252
1198 L D 0.9382
1199 H D -0.1842
1200 Q D -1.1114
1201 D D -1.1997
1202 W D 0.0000
1203 L D -0.9294
1204 N D -2.0274
1205 G D -1.9756
1206 K D -2.0044
1207 E D -2.0522
1208 Y D 0.0000
1209 K D -1.7172
1210 C D 0.0000
1211 K D -1.7595
1212 V D 0.0000
1213 S D -1.4807
1214 N D -1.8925
1215 K D -2.1264
1216 A D -1.3031
1217 L D -0.6170
1218 P D -0.4889
1219 A D -0.3303
1220 P D -0.4877
1221 I D -0.4607
1222 E D -1.6006
1223 K D -1.5033
1224 T D -1.1356
1225 I D -0.0425
1226 S D -1.3929
1227 K D -1.3327
1228 A D -1.2390
1229 K D -2.3145
1230 G D -2.1242
1231 Q D -2.2291
1232 P D -2.2981
1233 R D -2.9233
1234 E D -2.5983
1235 P D 0.0000
1236 Q D -1.1200
1237 V D 0.0000
1238 Y D 0.0000
1239 T D -0.7352
1240 L D 0.0000
1241 P D -0.3661
1242 P D -0.6834
1243 S D -1.2643
1244 R D -2.4464
1245 D D -2.6226
1246 E D 0.0000
1247 L D -1.2604
1248 T D -1.5724
1249 K D -2.7125
1250 N D -2.9851
1251 Q D -2.9177
1252 V D 0.0000
1253 S D 0.0000
1254 L D 0.0000
1255 T D 0.0000
1256 C D 0.0000
1257 L D 0.0000
1258 V D 0.0000
1259 K D -0.5125
1260 G D -0.9929
1261 F D 0.0000
1262 Y D -1.3639
1263 P D 0.0000
1264 S D -0.0273
1265 D D -0.9590
1266 I D 0.0000
1267 A D 0.0000
1268 V D 0.0000
1269 E D -0.8682
1270 W D 0.0000
1271 E D -1.7459
1272 S D 0.0000
1273 N D -2.2216
1274 G D -1.8872
1275 Q D -2.2177
1276 P D -1.9485
1277 E D -2.2222
1278 N D -2.0515
1279 N D -1.6573
1280 Y D -0.9636
1281 K D -0.7381
1282 T D -0.3956
1283 T D 0.0000
1284 P D 0.0315
1285 P D 0.3233
1286 V D 0.9135
1287 L D 1.1417
1288 D D -0.2620
1289 S D -1.2547
1290 D D -1.9813
1291 G D -0.8941
1292 S D -0.7228
1293 F D 0.2087
1294 F D 0.0000
1295 L D 0.0000
1296 Y D 0.0000
1297 S D 0.0000
1298 K D 0.0000
1299 L D 0.0000
1300 T D -0.9887
1301 V D -1.5492
1302 D D -3.0968
1303 K D -3.6456
1304 S D -2.8074
1305 R D -3.0528
1306 W D -2.2849
1307 Q D -2.6142
1308 Q D -2.4958
1309 G D -1.3386
1310 N D -1.3294
1311 V D -0.5606
1312 F D 0.0000
1313 S D -1.0207
1314 C D 0.0000
1315 S D 0.0000
1316 V D 0.0000
1317 M D 0.0000
1318 H D 0.0000
1319 E D -1.2260
1320 A D -1.9244
1321 L D 0.0000
1322 H D -1.8185
1323 N D -1.7826
1324 H D -1.2334
1325 Y D -0.7148
1326 T D -0.9893
1327 Q D -1.1480
1328 K D -1.1189
1329 S D -0.5050
1330 L D 0.0000
1331 S D 0.2326
1332 L D 0.9512
1333 S D 0.3485
1334 P D -0.0898
1335 G D -0.1095
1336 K D -0.4014

 

Laboratory of Theory of Biopolymers 2015