Project name: Model

Status: done

submitted: 2017-03-14 13:21:08, status changed: 2017-03-14 14:46:20
Settings
Chain sequence(s) A: QLLESGGGLVQPGGSLRLSCAASGFTFSDEDMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSYGAFDYWGQGTLVTVS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.5598
Maximal score value
1.527
Average score
-0.5079
Total score value
-57.3893

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.0244
2 L A 0.0000
3 L A 0.7308
4 E A 0.0000
5 S A -0.3142
6 G A -0.8305
7 G A 0.1180
8 G A 0.6705
9 L A 1.4244
10 V A -0.0621
11 Q A -1.3339
12 P A -1.6976
13 G A -1.5019
14 G A -1.0459
15 S A -1.3153
16 L A -0.9888
17 R A -2.0836
18 L A 0.0000
19 S A -0.4317
20 C A 0.0000
21 A A -0.2418
22 A A 0.0000
23 S A -0.6207
24 G A -0.6396
25 F A -0.3833
26 T A -0.7414
27 F A 0.0000
28 S A -1.6360
29 D A -2.0624
30 E A -1.3945
31 D A -1.1706
32 M A 0.0000
33 S A 0.0000
34 W A 0.0000
35 V A 0.0000
36 R A 0.0000
37 Q A -0.3698
38 A A -0.9970
39 P A -0.9562
40 G A -1.5774
41 K A -2.1069
42 G A -0.9801
43 L A 0.6107
44 E A -0.1974
45 W A 0.5571
46 V A 0.0000
47 S A 0.0000
48 A A 0.2585
49 I A 0.0000
50 S A -0.9037
51 G A -1.4895
52 S A -1.1661
53 G A -0.8979
54 G A -0.6986
55 S A -0.3131
56 T A 0.2631
57 Y A 0.7702
58 Y A -0.2347
59 A A -1.0414
60 D A -2.3455
61 S A -1.7300
62 V A 0.0000
63 K A -2.4301
64 G A -1.7629
65 R A -1.5026
66 F A 0.0000
67 T A -0.6796
68 I A 0.0000
69 S A -0.4161
70 R A -1.0617
71 D A -1.5020
72 N A -1.8550
73 S A -1.5766
74 K A -2.3983
75 N A -1.8695
76 T A -1.0372
77 L A 0.0000
78 Y A -0.4721
79 L A 0.0000
80 Q A -1.1276
81 M A 0.0000
82 N A -1.5154
83 S A -1.3128
84 L A 0.0000
85 R A -2.5598
86 A A -1.8386
87 E A -2.3543
88 D A 0.0000
89 T A -0.4579
90 A A 0.0000
91 V A 0.9014
92 Y A 0.0000
93 Y A 0.6440
94 C A 0.0000
95 A A 0.0000
96 K A 0.0553
97 S A 0.8493
98 Y A 0.8318
99 G A 0.1850
100 A A 0.7914
101 F A 1.4429
102 D A -0.3002
103 Y A 0.2454
104 W A 0.1354
105 G A -0.2316
106 Q A -0.7809
107 G A 0.0000
108 T A 0.5965
109 L A 1.5270
110 V A 0.0000
111 T A 0.3186
112 V A 0.0000
113 S A -0.7483

 

Laboratory of Theory of Biopolymers 2015