Project name: 130dae5b508aacf

Status: done

submitted: 2017-11-14 10:16:01, status changed: 2017-11-14 11:02:43
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCGPQLTAKLGFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCGPQLTAKLGFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.6823
Maximal score value
2.1959
Average score
-0.7918
Total score value
-1053.0332

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.4673
2 I A 0.4662
3 Q A 0.0000
4 M A -0.0758
5 T A 0.0000
6 Q A -0.9151
7 S A -0.5391
8 P A -0.7397
9 S A -0.7012
10 S A -0.4458
11 L A -0.1965
12 S A -0.5266
13 A A 0.0000
14 S A -0.7985
15 V A 0.1407
16 G A -0.8639
17 D A -1.8959
18 R A -2.4207
19 V A 0.0000
20 T A -0.6650
21 I A 0.0000
22 T A -0.6170
23 C A 0.0000
24 R A -1.3870
25 A A 0.0000
26 S A -0.9684
27 Q A -2.0367
28 G A -2.0316
29 I A 0.0000
30 R A -2.0668
31 N A -1.0619
32 Y A 0.5391
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A -0.8220
38 Q A -1.2528
39 K A -1.5970
40 P A -1.4677
41 G A -1.6326
42 K A -2.5299
43 A A -1.6148
44 P A 0.0000
45 K A -1.3259
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.6397
50 A A 0.2083
51 A A -0.1817
52 S A 0.1232
53 T A 0.2306
54 L A 0.4084
55 Q A -0.2621
56 S A -0.4054
57 G A -0.4838
58 V A -0.1226
59 P A -0.4055
60 S A -0.3160
61 R A -0.7134
62 F A 0.0000
63 S A -0.1903
64 G A -0.0760
65 S A -0.5451
66 G A -0.9820
67 S A -1.2799
68 G A -1.7420
69 T A -1.7637
70 D A -1.6279
71 F A 0.0000
72 T A -0.5761
73 L A 0.0000
74 T A -0.5911
75 I A 0.0000
76 S A -1.4245
77 S A -1.2351
78 L A 0.0000
79 Q A -1.1175
80 P A -1.5477
81 E A -2.0799
82 D A 0.0000
83 V A -0.9350
84 A A 0.0000
85 T A -0.5562
86 Y A 0.0000
87 Y A -0.3102
88 C A 0.0000
89 G A 0.0000
90 P A 0.0000
91 Q A -0.1753
92 L A -0.1498
93 T A -0.4124
94 A A -1.2941
95 K A -2.3004
96 L A -0.9008
97 G A -0.6699
98 F A 0.0000
99 G A 0.0000
100 Q A -1.5006
101 G A -1.1552
102 T A 0.0000
103 K A -0.7411
104 V A 0.0000
105 E A 0.0000
106 I A 0.0000
107 K A -1.2049
108 R A -1.1378
109 T A -0.0492
110 V A 1.0376
111 A A 0.4078
112 A A 0.0993
113 P A -0.1238
114 S A -0.3294
115 V A 0.0000
116 F A 0.0614
117 I A 0.0000
118 F A 0.0000
119 P A -0.4924
120 P A 0.0000
121 S A -1.8709
122 D A -3.3016
123 E A -3.2659
124 Q A 0.0000
125 L A 0.0000
126 K A -3.1213
127 S A -1.8606
128 G A -1.3058
129 T A -0.8644
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.8813
139 F A 0.0000
140 Y A 0.0000
141 P A -1.5281
142 R A -2.7047
143 E A -3.1057
144 A A -2.4397
145 K A -2.5590
146 V A 0.0000
147 Q A -1.1330
148 W A 0.0000
149 K A -0.5892
150 V A -0.8068
151 D A -1.8395
152 N A -1.3889
153 A A -0.3421
154 L A 0.4116
155 Q A -0.9397
156 S A -0.7633
157 G A -1.2226
158 N A -1.8932
159 S A -1.4954
160 Q A 0.0000
161 E A -1.6615
162 S A 0.0000
163 V A -0.1833
164 T A -0.8360
165 E A -2.0758
166 Q A 0.0000
167 D A -2.2991
168 S A -2.2206
169 K A -2.5158
170 D A -2.3022
171 S A -2.1927
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A -0.4466
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5246
181 L A -0.5834
182 S A -1.0189
183 K A -1.7724
184 A A -1.7125
185 D A -1.8479
186 Y A 0.0000
187 E A -2.7625
188 K A -3.1422
189 H A -2.8039
190 K A -3.0884
191 V A -1.7031
192 Y A 0.0000
193 A A -0.9805
194 C A 0.0000
195 E A -1.0498
196 V A 0.0000
197 T A -1.2239
198 H A 0.0000
199 Q A -1.7052
200 G A -0.3727
201 L A -0.0306
202 S A -0.3829
203 S A -0.3237
204 P A -0.5087
205 V A -0.0576
206 T A -0.5489
207 K A -0.8102
208 S A -0.8401
209 F A 0.0000
210 N A -2.2582
211 R A -2.4796
212 G A -1.9298
213 E A -2.4667
214 C A -1.8623
215 E B -2.0470
216 V B -1.2104
217 Q B -1.3012
218 L B 0.0000
219 V B 0.3666
220 E B 0.0000
221 S B -0.4879
222 G B -0.8379
223 G B -0.5477
224 G B -0.0109
225 L B 0.1785
226 V B -0.7445
227 Q B -2.0054
228 P B -2.1923
229 G B -2.3334
230 R B -2.7990
231 S B -2.0712
232 L B -1.6016
233 R B -2.2308
234 L B 0.0000
235 S B -0.5401
236 C B 0.0000
237 A B -0.1702
238 A B 0.0000
239 S B -0.9617
240 G B -1.0399
241 F B -0.6089
242 T B -0.8414
243 F B 0.0000
244 D B -2.5985
245 D B -1.8176
246 Y B -0.4317
247 A B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -1.0121
254 A B 0.0000
255 P B -1.0982
256 G B -1.4800
257 K B -2.4997
258 G B -1.8061
259 L B -1.2386
260 E B -1.7862
261 W B 0.0000
262 V B 0.0000
263 S B 0.0000
264 A B 0.0000
265 I B 0.0000
266 T B -0.8532
267 W B -0.9620
268 N B -2.1952
269 S B -1.3765
270 G B -1.3101
271 H B -1.3728
272 I B -0.4794
273 D B -1.9097
274 Y B -1.6363
275 A B -2.2743
276 D B -2.8568
277 S B -2.1698
278 V B 0.0000
279 E B -3.1379
280 G B -2.0511
281 R B -2.4012
282 F B 0.0000
283 T B -1.0085
284 I B 0.0000
285 S B -0.4550
286 R B 0.0000
287 D B -2.6274
288 N B -2.7172
289 A B -1.8553
290 K B -2.7049
291 N B -2.1469
292 S B 0.0000
293 L B 0.0000
294 Y B -0.6392
295 L B 0.0000
296 Q B -1.7642
297 M B 0.0000
298 N B -2.1131
299 S B -1.9315
300 L B 0.0000
301 R B -3.1909
302 A B -2.0677
303 E B -2.4817
304 D B 0.0000
305 T B -0.7265
306 A B 0.0000
307 V B 0.2261
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 V B 0.0000
314 S B 0.5854
315 Y B 1.7374
316 L B 1.8470
317 S B 1.0169
318 T B 0.8585
319 A B 0.0000
320 S B 0.9353
321 S B 0.3887
322 L B 0.0000
323 D B -0.0831
324 Y B -0.0751
325 W B 0.0000
326 G B 0.0000
327 Q B -1.2744
328 G B -0.5293
329 T B -0.0219
330 L B 0.3110
331 V B 0.0000
332 T B -0.1779
333 V B 0.0000
334 S B -0.9000
335 S B -0.6675
336 A B -0.6070
337 S B -0.8408
338 T B -1.0867
339 K B -1.8895
340 G B -1.8034
341 P B -1.0673
342 S B -0.7617
343 V B 0.0000
344 F B -0.7466
345 P B -1.2641
346 L B 0.0000
347 A B -0.8969
348 P B -0.8194
349 S B -1.2943
350 S B -1.4216
351 K B -1.9627
352 S B -1.4516
353 T B -0.9598
354 S B -0.9643
355 G B -0.7745
356 G B -0.7066
357 T B -0.5179
358 A B 0.0000
359 A B 0.0113
360 L B 0.0000
361 G B 0.0000
362 C B 0.0000
363 L B 0.0000
364 V B 0.0000
365 K B -0.6368
366 D B -1.4810
367 Y B 0.0000
368 F B 0.0000
369 P B 0.0000
370 E B -0.8269
371 P B -0.8334
372 V B -0.7030
373 T B -0.5617
374 V B -0.3011
375 S B -0.3067
376 W B 0.0000
377 N B -0.7482
378 S B -0.6421
379 G B -0.3734
380 A B -0.1582
381 L B 0.0635
382 T B -0.0780
383 S B -0.1001
384 G B -0.1289
385 V B 0.3688
386 H B -0.1018
387 T B 0.1077
388 F B 0.0000
389 P B -0.1715
390 A B 0.4148
391 V B 0.6938
392 L B 0.8447
393 Q B -0.2149
394 S B -0.2889
395 S B -0.2753
396 G B -0.6690
397 L B -0.5113
398 Y B -0.1594
399 S B 0.0000
400 L B 0.0000
401 S B 0.0000
402 S B 0.0000
403 V B 0.0000
404 V B 0.0000
405 T B -0.0633
406 V B 0.0000
407 P B -0.5685
408 S B -0.5958
409 S B -0.6715
410 S B -0.7888
411 L B -0.9194
412 G B -1.1895
413 T B -0.9286
414 Q B -1.3894
415 T B -1.2413
416 Y B 0.0000
417 I B -1.3414
418 C B 0.0000
419 N B -1.5768
420 V B 0.0000
421 N B -1.9952
422 H B 0.0000
423 K B -2.7431
424 P B -1.7191
425 S B -1.9692
426 N B -2.5611
427 T B -2.1773
428 K B -2.6563
429 V B -1.8895
430 D B -2.6714
431 K B -2.2106
432 K B -2.3241
433 V B 0.0000
434 E B -2.7826
435 P B -2.1657
436 K B -2.7732
437 S B -2.0242
438 C B -1.9649
439 D B -2.7363
440 K B -2.7106
441 T B -1.8340
442 H B -1.9586
443 T B -2.1265
444 C B 0.0000
445 P B -1.7297
446 P B -1.1074
447 C B -0.4688
448 P B -0.5652
449 A B -0.6750
450 P B -0.6088
451 E B -1.0403
452 L B 0.8926
453 L B 1.4002
454 G B 0.1859
455 G B -0.0551
456 P B 0.0000
457 S B 0.1979
458 V B 0.0000
459 F B 1.9757
460 L B 0.0000
461 F B 2.0464
462 P B 0.4873
463 P B 0.0000
464 K B -1.9500
465 P B -1.3104
466 K B -1.2872
467 D B -1.5420
468 T B 0.0000
469 L B 0.0000
470 M B 0.4459
471 I B 1.5217
472 S B -0.0931
473 R B -1.4483
474 T B -0.8217
475 P B 0.0000
476 E B -1.2930
477 V B 0.0000
478 T B 0.8654
479 C B 0.0000
480 V B 0.6498
481 V B 0.0000
482 V B -0.1318
483 D B -1.0614
484 V B 0.0000
485 S B -1.7450
486 H B -2.0743
487 E B -2.6803
488 D B 0.0000
489 P B -2.4081
490 E B -3.0390
491 V B 0.0000
492 K B -2.5812
493 F B 0.0000
494 N B -1.4690
495 W B 0.0000
496 Y B -1.4838
497 V B 0.0000
498 D B -2.2667
499 G B -1.0358
500 V B 0.3586
501 E B -1.2023
502 V B 0.0067
503 H B -1.2685
504 N B -1.2260
505 A B -1.0781
506 K B -2.1392
507 T B -1.5356
508 K B -2.3807
509 P B -1.9373
510 R B -3.0839
511 E B -2.9531
512 E B -2.8769
513 Q B -2.3615
514 Y B -1.1134
515 N B -1.3423
516 S B -1.0708
517 T B -1.4346
518 Y B -2.0556
519 R B -1.9338
520 V B 0.0000
521 V B -0.8165
522 S B 0.0000
523 V B -0.1206
524 L B 0.0000
525 T B -0.4861
526 V B 0.3893
527 L B 1.1189
528 H B 0.0000
529 Q B -0.9362
530 D B -0.9154
531 W B 0.0000
532 L B -0.8640
533 N B -1.8970
534 G B -1.9250
535 K B -1.9854
536 E B -2.2720
537 Y B 0.0000
538 K B -2.0323
539 C B 0.0000
540 K B -1.8518
541 V B 0.0000
542 S B -1.4676
543 N B -1.8321
544 K B -2.0373
545 A B -1.1868
546 L B -0.5486
547 P B -0.4269
548 A B -0.3667
549 P B -0.5578
550 I B -0.5438
551 E B -1.4972
552 K B -1.2222
553 T B -1.0302
554 I B 0.2026
555 S B -1.4056
556 K B -1.2753
557 A B -1.2380
558 K B -2.3080
559 G B -2.0719
560 Q B -2.1244
561 P B -2.1057
562 R B -2.5897
563 E B -2.5663
564 P B 0.0000
565 Q B -1.5606
566 V B 0.0000
567 Y B 0.0000
568 T B 0.0000
569 L B -0.2723
570 P B -0.3857
571 P B 0.0000
572 S B -1.2682
573 R B -2.4466
574 D B -2.5428
575 E B 0.0000
576 L B -0.5881
577 T B -0.7772
578 K B -1.4033
579 N B -2.1480
580 Q B -2.0629
581 V B 0.0000
582 S B 0.0000
583 L B 0.0000
584 T B 0.0000
585 C B 0.0000
586 L B 0.0000
587 V B 0.0000
588 K B 0.0000
589 G B -1.0942
590 F B 0.0000
591 Y B -1.2288
592 P B 0.0000
593 S B -0.0169
594 D B -0.7851
595 I B 0.0000
596 A B -0.5685
597 V B 0.0000
598 E B -1.1751
599 W B 0.0000
600 E B -1.9489
601 S B 0.0000
602 N B -2.0422
603 G B -1.8357
604 Q B -2.2502
605 P B -2.0870
606 E B -2.4428
607 N B -2.1979
608 N B -1.7215
609 Y B -1.0737
610 K B -0.8273
611 T B -0.4409
612 T B 0.0000
613 P B -0.0351
614 P B 0.2212
615 V B 0.5265
616 L B 0.6193
617 D B -0.5910
618 S B -1.4619
619 D B -1.9865
620 G B -0.8315
621 S B 0.0000
622 F B 0.1216
623 F B 0.0000
624 L B 0.0000
625 Y B 0.0000
626 S B 0.0000
627 K B 0.0000
628 L B 0.0000
629 T B -0.9453
630 V B -1.3073
631 D B -2.5421
632 K B -2.2513
633 S B -2.0410
634 R B -2.1243
635 W B 0.0000
636 Q B -2.6045
637 Q B -2.4143
638 G B -1.3398
639 N B -1.1838
640 V B -0.4468
641 F B 0.0000
642 S B -1.1665
643 C B 0.0000
644 S B 0.0000
645 V B 0.0000
646 M B 0.0000
647 H B 0.0000
648 E B -1.1320
649 A B -1.7681
650 L B 0.0000
651 H B -1.7939
652 N B -1.7440
653 H B -1.2397
654 Y B -0.6776
655 T B -1.1465
656 Q B -1.4018
657 K B -1.1146
658 S B -0.3912
659 L B 0.0000
660 S B 0.0307
661 L B 1.0208
662 S B 0.1569
663 P B -0.4545
664 G B -0.9896
665 K B -0.7897
666 D C -1.4447
667 I C 0.3954
668 Q C 0.0000
669 M C -0.5602
670 T C 0.0000
671 Q C -1.8708
672 S C -1.0315
673 P C -1.2556
674 S C -1.0776
675 S C -1.0192
676 L C -0.6364
677 S C -1.0628
678 A C 0.0000
679 S C -0.8509
680 V C 0.3352
681 G C -0.6619
682 D C -1.8223
683 R C -2.4291
684 V C 0.0000
685 T C -0.7211
686 I C 0.0000
687 T C -1.2402
688 C C 0.0000
689 R C -2.5121
690 A C 0.0000
691 S C -1.1626
692 Q C -2.1358
693 G C -2.1874
694 I C 0.0000
695 R C -2.0551
696 N C -1.1057
697 Y C 0.3387
698 L C 0.0000
699 A C 0.0000
700 W C 0.0000
701 Y C 0.0000
702 Q C -1.2541
703 Q C -1.9996
704 K C -2.8777
705 P C -2.1124
706 G C -2.1236
707 K C -2.9246
708 A C -1.9220
709 P C 0.0000
710 K C -1.8214
711 L C 0.0000
712 L C 0.0000
713 I C 0.0000
714 Y C 0.5940
715 A C 0.1700
716 A C -0.1894
717 S C 0.0955
718 T C 0.1974
719 L C 0.1898
720 Q C -0.3010
721 S C -0.4063
722 G C -0.4943
723 V C -0.3263
724 P C -0.8440
725 S C -0.8998
726 R C -1.7700
727 F C 0.0000
728 S C -0.4869
729 G C -0.0897
730 S C -0.6457
731 G C -1.3232
732 S C -1.5354
733 G C -2.0198
734 T C -2.2969
735 D C -2.6846
736 F C 0.0000
737 T C -0.9511
738 L C 0.0000
739 T C -0.7422
740 I C 0.0000
741 S C -1.5904
742 S C -1.2164
743 L C 0.0000
744 Q C -0.6454
745 P C -1.4111
746 E C -2.2110
747 D C 0.0000
748 V C -1.3867
749 A C 0.0000
750 T C -1.2788
751 Y C 0.0000
752 Y C 0.0000
753 C C 0.0000
754 G C 0.0000
755 P C 0.0000
756 Q C -0.2462
757 L C -0.4013
758 T C -0.5051
759 A C -1.2291
760 K C -2.1322
761 L C -0.8124
762 G C -0.5338
763 F C 0.0000
764 G C 0.0000
765 Q C -1.6782
766 G C -1.4672
767 T C 0.0000
768 K C -1.8391
769 V C 0.0000
770 E C -1.5057
771 I C 0.0000
772 K C -1.6776
773 R C -1.3074
774 T C -0.0561
775 V C 1.0181
776 A C 0.4096
777 A C 0.0821
778 P C -0.3544
779 S C -0.3333
780 V C 0.0000
781 F C 0.2068
782 I C 0.0000
783 F C 0.0000
784 P C 0.0000
785 P C 0.0000
786 S C 0.0000
787 D C -3.0489
788 E C -3.0436
789 Q C 0.0000
790 L C 0.0000
791 K C -2.9238
792 S C -1.8591
793 G C -1.4215
794 T C -0.9767
795 A C 0.0000
796 S C 0.0000
797 V C 0.0000
798 V C 0.0000
799 C C 0.0000
800 L C 0.0000
801 L C 0.0000
802 N C 0.0000
803 N C -1.1913
804 F C 0.0000
805 Y C 0.0000
806 P C -1.8591
807 R C -3.2282
808 E C -3.3277
809 A C -2.5882
810 K C -2.6015
811 V C -1.4282
812 Q C -1.2702
813 W C 0.0000
814 K C -0.5453
815 V C -0.7748
816 D C -1.4825
817 N C -1.2935
818 A C -0.4015
819 L C 0.1680
820 Q C -1.1332
821 S C -0.9023
822 G C -1.3185
823 N C -2.0165
824 S C -1.5860
825 Q C -1.3201
826 E C -1.6687
827 S C 0.0000
828 V C -0.7536
829 T C -1.1618
830 E C -2.3989
831 Q C 0.0000
832 D C -2.7240
833 S C -2.5839
834 K C -2.9561
835 D C -3.1585
836 S C -2.7462
837 T C 0.0000
838 Y C 0.0000
839 S C 0.0000
840 L C 0.0000
841 S C 0.0000
842 S C 0.0000
843 T C -0.6897
844 L C 0.0000
845 T C -0.5882
846 L C -0.6504
847 S C -1.3102
848 K C -2.2683
849 A C -2.1405
850 D C -2.3678
851 Y C 0.0000
852 E C -3.6823
853 K C -3.5593
854 H C -2.9890
855 K C -3.0690
856 V C -1.2765
857 Y C 0.0000
858 A C -0.8635
859 C C 0.0000
860 E C -1.1420
861 V C 0.0000
862 T C -1.2429
863 H C 0.0000
864 Q C -1.7552
865 G C -0.3456
866 L C 0.0013
867 S C -0.3752
868 S C -0.3275
869 P C -0.5390
870 V C -0.0773
871 T C -0.5590
872 K C -0.8359
873 S C -0.5942
874 F C 0.0000
875 N C -1.7480
876 R C -1.9487
877 G C -1.4425
878 E C -1.4516
879 C C -0.4818
880 E D -2.0137
881 V D -1.0218
882 Q D -1.3835
883 L D 0.0000
884 V D 0.2015
885 E D 0.0000
886 S D -0.4792
887 G D -0.7267
888 G D -0.3679
889 G D 0.1012
890 L D 0.0615
891 V D 0.0000
892 Q D -2.0874
893 P D -2.2450
894 G D -2.2889
895 R D -2.7338
896 S D -1.8964
897 L D -1.1058
898 R D -1.8714
899 L D 0.0000
900 S D -0.5398
901 C D 0.0000
902 A D -0.2561
903 A D -0.5533
904 S D -1.0070
905 G D -0.9815
906 F D -0.4829
907 T D -0.6532
908 F D 0.0000
909 D D -1.9888
910 D D -1.5324
911 Y D -0.0237
912 A D 0.0000
913 M D 0.0000
914 H D 0.0000
915 W D 0.0000
916 V D 0.0000
917 R D -0.5127
918 Q D -0.9319
919 A D -1.1906
920 P D -1.0821
921 G D -1.4847
922 K D -2.4625
923 G D -1.7484
924 L D -1.0905
925 E D -1.3716
926 W D 0.0000
927 V D 0.0000
928 S D 0.0000
929 A D 0.0000
930 I D 0.0000
931 T D 0.0000
932 W D -0.6612
933 N D -1.6427
934 S D -0.9843
935 G D -1.0999
936 H D -1.1611
937 I D -0.3936
938 D D -1.8650
939 Y D -1.7948
940 A D -2.2958
941 D D -2.8878
942 S D -2.2707
943 V D 0.0000
944 E D -3.3563
945 G D -2.3777
946 R D -2.9968
947 F D 0.0000
948 T D -1.0555
949 I D 0.0000
950 S D -0.3533
951 R D -0.9944
952 D D -1.5364
953 N D -1.8816
954 A D -1.4071
955 K D -2.3415
956 N D -1.8669
957 S D 0.0000
958 L D 0.0000
959 Y D -0.4558
960 L D 0.0000
961 Q D -1.3542
962 M D 0.0000
963 N D -2.2179
964 S D -1.9855
965 L D 0.0000
966 R D -3.2408
967 A D -2.0661
968 E D -2.4918
969 D D 0.0000
970 T D -0.7202
971 A D 0.0000
972 V D 0.4270
973 Y D 0.0000
974 Y D 0.0000
975 C D 0.0000
976 A D 0.0000
977 K D 0.0000
978 V D 0.0000
979 S D 0.0000
980 Y D 1.3448
981 L D 1.1427
982 S D 0.7371
983 T D 0.7305
984 A D 0.0000
985 S D 0.4452
986 S D 0.0000
987 L D 0.0000
988 D D -0.2563
989 Y D -0.0671
990 W D 0.0000
991 G D 0.0000
992 Q D -1.3464
993 G D 0.0000
994 T D 0.1498
995 L D 0.7459
996 V D 0.0000
997 T D -0.1704
998 V D 0.0000
999 S D -0.9889
1000 S D -0.7298
1001 A D -0.5778
1002 S D -0.7521
1003 T D -0.8072
1004 K D -1.3907
1005 G D -1.3182
1006 P D -0.6164
1007 S D -0.4960
1008 V D 0.0000
1009 F D -0.7291
1010 P D 0.0000
1011 L D 0.0000
1012 A D 0.0000
1013 P D 0.0000
1014 S D 0.0000
1015 S D -1.1046
1016 K D -1.9782
1017 S D -1.2336
1018 T D -0.9605
1019 S D -0.8808
1020 G D -0.7719
1021 G D -0.6976
1022 T D -0.5355
1023 A D 0.0000
1024 A D 0.0292
1025 L D 0.0000
1026 G D 0.0000
1027 C D 0.0000
1028 L D 0.0000
1029 V D 0.0000
1030 K D -0.2794
1031 D D -0.6204
1032 Y D 0.0000
1033 F D 0.0000
1034 P D 0.0000
1035 E D -0.5390
1036 P D -0.7025
1037 V D -0.7904
1038 T D -0.5217
1039 V D -0.2840
1040 S D -0.3002
1041 W D 0.0000
1042 N D -0.8485
1043 S D -0.6733
1044 G D -0.3869
1045 A D -0.1819
1046 L D 0.0714
1047 T D -0.0722
1048 S D -0.0841
1049 G D -0.0342
1050 V D 0.3734
1051 H D -0.1372
1052 T D 0.0299
1053 F D 0.0000
1054 P D -0.3167
1055 A D 0.1492
1056 V D 0.5472
1057 L D 1.0576
1058 Q D -0.5381
1059 S D -0.3574
1060 S D -0.3696
1061 G D 0.0000
1062 L D 0.0537
1063 Y D 0.2507
1064 S D 0.0836
1065 L D 0.0000
1066 S D 0.0000
1067 S D 0.0000
1068 V D 0.0000
1069 V D 0.0000
1070 T D -0.0541
1071 V D 0.0000
1072 P D -0.5947
1073 S D -0.6324
1074 S D -0.7035
1075 S D -0.8337
1076 L D 0.0000
1077 G D -1.2595
1078 T D -0.9650
1079 Q D -1.3827
1080 T D -1.3720
1081 Y D 0.0000
1082 I D -1.4681
1083 C D 0.0000
1084 N D -1.5024
1085 V D 0.0000
1086 N D -1.8952
1087 H D 0.0000
1088 K D -2.6911
1089 P D -1.6466
1090 S D -1.8751
1091 N D -2.5057
1092 T D -2.0930
1093 K D -2.5869
1094 V D -1.7430
1095 D D -2.5750
1096 K D -2.1539
1097 K D -2.7104
1098 V D 0.0000
1099 E D -2.5924
1100 P D -1.4678
1101 K D -1.1609
1102 S D -1.2894
1103 C D -0.7926
1104 D D -2.1233
1105 K D -2.6033
1106 T D -1.4161
1107 H D -1.3806
1108 T D -1.6562
1109 C D -1.4042
1110 P D -0.9315
1111 P D -0.7020
1112 C D -0.5912
1113 P D -0.6139
1114 A D -0.8924
1115 P D -0.9485
1116 E D -1.4128
1117 L D 0.1357
1118 L D 1.3218
1119 G D 0.0526
1120 G D -0.2455
1121 P D -0.0997
1122 S D 0.2192
1123 V D 0.0000
1124 F D 2.1643
1125 L D 1.7655
1126 F D 2.1959
1127 P D 0.5650
1128 P D 0.0000
1129 K D -1.8391
1130 P D -1.3169
1131 K D -1.1354
1132 D D 0.0000
1133 T D 0.0000
1134 L D 0.0000
1135 M D 0.6429
1136 I D 1.5905
1137 S D 0.1123
1138 R D -0.9536
1139 T D -0.4645
1140 P D 0.0000
1141 E D -0.5860
1142 V D 0.0000
1143 T D 1.1528
1144 C D 0.0000
1145 V D 1.1130
1146 V D 0.0000
1147 V D 0.0901
1148 D D -0.2029
1149 V D 0.0000
1150 S D -1.6694
1151 H D -2.4668
1152 E D -2.8214
1153 D D -2.2779
1154 P D -2.1976
1155 E D -2.2864
1156 V D 0.0000
1157 K D -2.0200
1158 F D 0.0000
1159 N D -1.4686
1160 W D 0.0000
1161 Y D -1.0215
1162 V D -0.8562
1163 D D -2.0395
1164 G D -0.7305
1165 V D 0.8259
1166 E D -0.3532
1167 V D 0.1135
1168 H D -1.2570
1169 N D -1.1081
1170 A D -1.1144
1171 K D -2.0435
1172 T D 0.0000
1173 K D -2.0297
1174 P D -1.9995
1175 R D -2.6492
1176 E D -3.1783
1177 E D -2.7361
1178 Q D -2.2019
1179 Y D -0.8807
1180 N D -0.7373
1181 S D -0.8165
1182 T D 0.0000
1183 Y D 0.0000
1184 R D -1.5202
1185 V D 0.0000
1186 V D -0.5322
1187 S D 0.0000
1188 V D 0.2828
1189 L D 0.0000
1190 T D -0.1599
1191 V D 0.5121
1192 L D 1.1104
1193 H D 0.1142
1194 Q D -1.0107
1195 D D -0.9338
1196 W D 0.0000
1197 L D -0.8763
1198 N D -1.9693
1199 G D -2.1130
1200 K D -2.1949
1201 E D -2.4466
1202 Y D 0.0000
1203 K D -1.7902
1204 C D 0.0000
1205 K D -1.6269
1206 V D 0.0000
1207 S D -1.2735
1208 N D -1.6838
1209 K D -2.0999
1210 A D -1.2763
1211 L D -0.5839
1212 P D -0.4645
1213 A D -0.2932
1214 P D -0.4242
1215 I D -0.2932
1216 E D -1.2736
1217 K D -1.0201
1218 T D -1.0446
1219 I D -0.0725
1220 S D -1.6310
1221 K D -1.5025
1222 A D -1.3657
1223 K D -2.3520
1224 G D -2.1180
1225 Q D -2.2158
1226 P D -2.3595
1227 R D -3.1286
1228 E D -2.9928
1229 P D 0.0000
1230 Q D -1.7220
1231 V D 0.0000
1232 Y D 0.0000
1233 T D -0.7278
1234 L D 0.0000
1235 P D -0.3761
1236 P D 0.0000
1237 S D -1.4018
1238 R D -2.6192
1239 D D -2.8027
1240 E D 0.0000
1241 L D -1.4645
1242 T D -1.4842
1243 K D -2.3693
1244 N D -2.6591
1245 Q D -2.5540
1246 V D 0.0000
1247 S D 0.0000
1248 L D 0.0000
1249 T D 0.0000
1250 C D 0.0000
1251 L D 0.0000
1252 V D 0.0000
1253 K D -0.7760
1254 G D -1.2528
1255 F D 0.0000
1256 Y D -1.3964
1257 P D 0.0000
1258 S D -0.2839
1259 D D -1.0099
1260 I D 0.0000
1261 A D -0.5671
1262 V D 0.0000
1263 E D -1.3829
1264 W D 0.0000
1265 E D -1.9487
1266 S D 0.0000
1267 N D -2.1061
1268 G D -1.7538
1269 Q D -2.1458
1270 P D -1.9523
1271 E D -2.1956
1272 N D -2.2960
1273 N D -2.0948
1274 Y D -1.4346
1275 K D -1.2951
1276 T D -0.6728
1277 T D 0.0000
1278 P D -0.0946
1279 P D 0.1926
1280 V D 0.6142
1281 L D 0.7408
1282 D D -0.4599
1283 S D -1.3216
1284 D D -1.9594
1285 G D -0.8350
1286 S D -0.8011
1287 F D 0.0937
1288 F D 0.0000
1289 L D 0.0000
1290 Y D 0.0000
1291 S D 0.0000
1292 K D 0.0000
1293 L D 0.0000
1294 T D 0.0000
1295 V D 0.0000
1296 D D -2.5656
1297 K D -2.3826
1298 S D -2.0549
1299 R D -2.2881
1300 W D 0.0000
1301 Q D -2.6463
1302 Q D -2.6701
1303 G D -1.5227
1304 N D -1.3244
1305 V D -0.5094
1306 F D 0.0000
1307 S D -1.1861
1308 C D 0.0000
1309 S D -0.8408
1310 V D 0.0000
1311 M D -0.5510
1312 H D 0.0000
1313 E D -1.1804
1314 A D -1.9017
1315 L D 0.0000
1316 H D -1.7019
1317 N D -1.6035
1318 H D -0.7807
1319 Y D -0.2593
1320 T D -0.9534
1321 Q D -1.3662
1322 K D -1.1692
1323 S D -0.4412
1324 L D 0.1898
1325 S D -0.0392
1326 L D 1.0818
1327 S D -0.0875
1328 P D -0.8383
1329 G D -1.3583
1330 K D -1.0138

 

Laboratory of Theory of Biopolymers 2015