Project name: L. discolor Lipochalin

Status: done

submitted: 2017-11-15 01:21:07, status changed: 2017-11-15 01:27:05
Settings
Chain sequence(s) A: QFAGTWHVTAAVSNCSVFLKMKDGMKSFVAAISFTPEGNMAMKLFWPMPDTCQTFEMLFQQRGQAGHYLGTCTIWGPLAAQEKRDLRVMETDYSSYAIVHQLQQSGQKPKTMLQLLTREQDVSPHLLQKFKELIPTMGLTEDMLAVLPKSGECQEGTG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.9313
Maximal score value
2.5383
Average score
-0.6043
Total score value
-95.4745

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -0.5148
2 F A 0.3328
3 A A 0.1847
4 G A -0.2305
5 T A -0.5959
6 W A 0.0000
7 H A -1.1764
8 V A -0.3487
9 T A 0.0000
10 A A 0.0000
11 A A 0.0000
12 V A 0.0000
13 S A 0.0000
14 N A -0.8248
15 C A -0.0347
16 S A 0.4653
17 V A 1.6905
18 F A 1.0387
19 L A 0.0000
20 K A 0.1663
21 M A 0.5180
22 K A -0.3517
23 D A 0.0000
24 G A 0.0429
25 M A 0.0000
26 K A 0.0027
27 S A -0.0970
28 F A 0.0000
29 V A -0.0775
30 A A 0.0000
31 A A -0.4884
32 I A 0.0000
33 S A 0.7693
34 F A 1.5399
35 T A 0.2312
36 P A -0.7111
37 E A -1.9728
38 G A -1.0543
39 N A 0.0000
40 M A 0.0000
41 A A 0.3159
42 M A 0.0000
43 K A -0.8717
44 L A 0.0000
45 F A 0.0000
46 W A 0.0289
47 P A -0.4765
48 M A -0.4119
49 P A -0.9627
50 D A -1.7676
51 T A -0.7928
52 C A -0.8350
53 Q A -0.2249
54 T A -0.4861
55 F A -0.7365
56 E A -1.5426
57 M A -0.1279
58 L A 0.7851
59 F A 0.0000
60 Q A -1.6822
61 Q A -2.0633
62 R A -1.9016
63 G A -1.6218
64 Q A -1.8390
65 A A -0.9952
66 G A -0.7365
67 H A -1.3147
68 Y A 0.0000
69 L A -0.6372
70 G A 0.0000
71 T A 0.0193
72 C A 0.0000
73 T A 1.0229
74 I A 2.5383
75 W A 1.8123
76 G A 0.7329
77 P A 0.2415
78 L A 0.0000
79 A A 0.3958
80 A A 0.3269
81 Q A -0.2766
82 E A -1.2400
83 K A -1.5044
84 R A 0.0000
85 D A -0.8648
86 L A 0.0000
87 R A -0.8263
88 V A -0.1362
89 M A -0.2827
90 E A -0.9250
91 T A -0.6535
92 D A -1.4084
93 Y A 0.0039
94 S A -0.6142
95 S A -0.9702
96 Y A -0.5957
97 A A 0.0000
98 I A 0.0000
99 V A 0.0000
100 H A -0.1438
101 Q A 0.0000
102 L A -0.2001
103 Q A 0.0000
104 Q A -1.8105
105 S A -1.9271
106 G A -1.9516
107 Q A -2.4066
108 K A -2.6665
109 P A -1.8955
110 K A 0.0000
111 T A -0.3989
112 M A 0.0000
113 L A 0.0000
114 Q A 0.0544
115 L A 0.0000
116 L A 0.0000
117 T A 0.0000
118 R A -1.5230
119 E A -2.7708
120 Q A -2.3520
121 D A -2.7093
122 V A -1.2497
123 S A -0.8860
124 P A -1.1878
125 H A -1.5873
126 L A -0.9996
127 L A -1.1741
128 Q A -2.3231
129 K A -2.0545
130 F A 0.0000
131 K A -2.2371
132 E A -2.2344
133 L A -1.0074
134 I A 0.0000
135 P A -1.1141
136 T A -0.4971
137 M A -0.2497
138 G A -0.9182
139 L A 0.0000
140 T A -1.8417
141 E A -2.9313
142 D A -2.5393
143 M A -1.2627
144 L A -0.8840
145 A A -0.0680
146 V A 0.9025
147 L A 0.0000
148 P A -1.2144
149 K A -1.9454
150 S A -1.1808
151 G A -1.3294
152 E A -1.6309
153 C A -1.7453
154 Q A -2.4699
155 E A -2.7183
156 G A -1.8990
157 T A -1.5504
158 G A -1.1465

 

Laboratory of Theory of Biopolymers 2015