Project name: gqs-p75

Status: done

submitted: 2018-08-01 13:42:51, status changed: 2018-08-01 13:49:11
Settings
Chain sequence(s) H: VTLKESGGGVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISGDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKPRGVGAALDYWGQGTLVTVS
L: PVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGLAFGGGTKLTVL
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5476
Maximal score value
1.7918
Average score
-0.7123
Total score value
-160.9737

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 P L 0.2634
3 V L 1.3764
4 L L 0.0000
5 T L 0.0814
6 Q L 0.0000
7 P L -0.6409
8 P L -0.9674
10 S L -1.0803
11 A L -0.8161
12 S L -0.4913
13 G L -0.4488
14 T L -0.4805
15 P L -1.1383
16 G L -1.8195
17 Q L -2.4709
18 R L -2.6804
19 V L 0.0000
20 T L -0.7089
21 I L 0.0000
22 S L -0.3944
23 C L 0.0000
24 S L -0.3204
25 G L -0.2532
26 S L -0.5852
27 S L -0.9243
28 S L -1.0226
29 N L 0.0000
30 I L 0.0000
30A G L -0.9114
30B S L -0.6126
31 N L -0.1490
32 Y L 0.7484
33 V L 0.0000
34 Y L 0.0000
35 W L 0.0000
36 Y L 0.0000
37 Q L -1.0635
38 Q L 0.0000
39 L L -0.5228
40 P L -0.3786
41 G L -0.5834
42 T L -0.6639
43 A L -0.7069
44 P L 0.0000
45 K L -1.5597
46 L L 0.0000
47 L L 0.0000
48 I L 0.0000
49 Y L -0.6954
50 S L -0.4440
51 N L -1.2321
52 N L -2.3920
53 Q L -2.4412
54 R L -2.5796
55 P L -1.4392
56 S L -1.0361
57 G L -0.9678
58 V L -1.3448
59 P L -1.4609
60 D L -2.6326
61 R L -1.6006
62 F L 0.0000
63 S L -1.5398
64 G L -1.2884
65 S L -1.0617
66 K L -1.1439
67 S L -0.8892
68 G L -0.9905
69 T L -0.8432
70 S L -0.7701
71 A L 0.0000
72 S L -0.6311
73 L L 0.0000
74 A L -0.6979
75 I L 0.0000
76 S L -1.9776
77 G L -1.6231
78 L L 0.0000
79 Q L -2.0330
80 S L -1.6115
81 E L -2.3972
82 D L 0.0000
83 E L -1.9499
84 A L 0.0000
85 D L -1.4862
86 Y L 0.0000
87 Y L 0.0000
88 C L 0.0000
89 A L 0.0000
90 A L 0.0000
91 W L -0.1800
92 D L 0.0000
93 D L -1.9238
94 S L -1.2236
95 L L -1.2045
95A N L -1.7507
95B G L 0.0000
96 L L 0.0000
97 A L 0.0000
98 F L 0.0000
99 G L 0.0000
100 G L -0.6975
101 G L -1.0207
102 T L 0.0000
103 K L -2.1827
104 L L 0.0000
105 T L -0.3874
106 V L -0.0577
107 L L 1.4063
2 V H 1.6451
3 T H 0.1992
4 L H 0.0000
5 K H -2.1872
6 E H -1.3735
7 S H -1.0784
8 G H -0.5826
9 G H 0.2082
10 G H 0.6678
11 V H 1.5438
12 V H 0.0000
13 Q H -1.2847
14 P H -1.4395
15 G H -1.3588
16 G H -1.1968
17 S H -1.5970
18 L H -1.0944
19 R H -2.1689
20 L H 0.0000
21 S H -1.0308
22 C H 0.0000
23 A H -1.2525
24 A H 0.0000
25 S H -0.3075
26 G H 0.3674
27 F H 0.0565
28 T H -1.0667
29 F H 0.0000
30 D H -3.5476
31 D H -2.9145
32 Y H -1.5847
33 A H -1.1139
34 M H 0.0000
35 H H 0.0000
36 W H 0.0000
37 V H 0.0000
38 R H 0.0000
39 Q H -0.6103
40 A H -0.9884
41 P H -0.7881
42 G H -1.4539
43 K H -2.2504
44 G H -1.2435
45 L H 0.0000
46 E H -0.7400
47 W H 0.0000
48 V H 0.0000
49 S H 0.0000
50 L H 0.0000
51 I H 0.0000
52 S H -1.2067
52A G H -2.2654
53 D H -2.9696
54 G H -1.7163
55 G H -1.2187
56 S H -0.5894
57 T H -0.1200
58 Y H -0.0455
59 Y H -1.0505
60 A H 0.0000
61 D H -2.6986
62 S H -2.0088
63 V H 0.0000
64 K H -2.9896
65 G H -2.6327
66 R H -3.1932
67 F H 0.0000
68 T H -1.1693
69 I H 0.0000
70 S H -0.6252
71 R H -1.6989
72 D H -2.6053
73 N H -3.4867
74 S H -2.2589
75 K H -2.6585
76 N H -2.4354
77 S H 0.0000
78 L H 0.0000
79 Y H -0.6378
80 L H 0.0000
81 Q H -1.5102
82 M H 0.0000
82A N H -2.1137
82B S H -1.6820
82C L H 0.0000
83 R H -2.0349
84 T H -1.6199
85 E H -2.1057
86 D H 0.0000
87 T H -0.2550
88 A H 0.0000
89 L H 0.9206
90 Y H 0.0000
91 Y H 0.0000
92 C H 0.0000
93 A H 0.0000
94 K H 0.0000
95 P H -0.4839
96 R H -1.1401
97 G H -0.5378
98 V H 0.7143
99 G H 0.0475
100 A H 0.0000
100A A H 0.0000
100B L H 0.0000
101 D H 0.0000
102 Y H -0.0343
103 W H -0.4547
104 G H 0.0000
105 Q H -1.6705
106 G H -0.6137
107 T H 0.1896
108 L H 1.7918
109 V H 0.0000
110 T H 0.5008
111 V H 0.0000
112 S H -0.6858

 

Laboratory of Theory of Biopolymers 2015