Project name: 1dc43ccd778129

Status: done

submitted: 2017-11-14 10:16:03, status changed: 2017-11-14 11:38:17
Settings
Chain sequence(s) A: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
C: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCIPIWWVLVGVLGGLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCIPIWWVLVGVLGGLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7061
Maximal score value
2.0242
Average score
-0.6659
Total score value
-888.3382

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3478
2 A A -0.2333
3 V A 0.0000
4 L A 1.0621
5 T A -0.1539
6 Q A -1.0834
7 P A -0.8628
8 P A -0.8917
9 S A -0.8374
10 V A 0.0184
11 S A 0.4394
12 G A 0.0000
13 A A -0.5807
14 P A -1.0645
15 G A -1.5855
16 Q A -2.2449
17 R A -2.6635
18 V A -1.0866
19 T A -0.6491
20 I A 0.0000
21 S A 0.0000
22 C A 0.0000
23 T A 0.0269
24 G A 0.0000
25 S A -0.4707
26 S A -0.5500
27 S A -0.1227
28 N A 0.0000
29 I A 1.5479
30 G A 0.2262
31 A A 0.3349
32 G A 0.2867
33 Y A 1.1902
34 G A 0.0000
35 V A 0.0000
36 H A 0.0000
37 W A 0.0000
38 Y A 0.0000
39 Q A 0.0000
40 Q A -0.3431
41 L A -0.3240
42 P A -0.7354
43 G A -0.6889
44 T A -0.6370
45 A A 0.0000
46 P A 0.0000
47 K A 0.2981
48 L A 0.0000
49 L A 0.0000
50 I A 0.0000
51 Y A -0.4108
52 G A -0.6547
53 D A -1.8189
54 S A -1.7438
55 N A -2.0819
56 R A -2.0839
57 P A -0.9214
58 S A -0.7333
59 G A -0.7505
60 V A -1.2124
61 P A -1.9032
62 D A -2.8495
63 R A -2.8624
64 F A 0.0000
65 S A -1.5063
66 G A -0.9863
67 S A -1.0590
68 K A -0.6857
69 S A -0.1976
70 G A 0.1019
71 T A -0.1557
72 S A -0.2153
73 A A 0.0000
74 S A -0.6394
75 L A 0.0000
76 A A -0.7160
77 I A 0.0000
78 T A -2.0909
79 G A 0.0000
80 L A 0.0000
81 Q A -1.1881
82 A A -1.4623
83 E A -2.0217
84 D A 0.0000
85 E A -1.1520
86 A A 0.0000
87 D A -1.0452
88 Y A 0.0000
89 Y A 0.0000
90 C A 0.0000
91 Q A 0.0000
92 S A 0.0000
93 Y A 0.0000
94 D A -0.6560
95 N A -1.1831
96 S A 0.1915
97 L A 1.0837
98 S A -0.0277
99 G A 0.0000
100 Y A -0.1470
101 V A -0.0945
102 F A 0.0000
103 G A 0.0000
104 G A -0.7233
105 G A -0.9973
106 T A 0.0000
107 Q A -1.3385
108 L A 0.0000
109 T A -0.0549
110 V A 0.0000
111 L A 0.7719
112 G A -0.2369
113 Q A -1.0820
114 P A -1.2771
115 K A -2.2815
116 A A -1.4631
117 A A -0.9737
118 P A 0.0000
119 S A -0.2548
120 V A 0.0807
121 T A 0.1375
122 L A 0.0000
123 F A 0.0000
124 P A -0.1641
125 P A 0.0000
126 S A -0.6302
127 S A -0.9335
128 E A -1.1785
129 E A 0.0000
130 L A -1.7035
131 Q A -2.1303
132 A A -1.5203
133 N A -2.4704
134 K A -2.1998
135 A A 0.0000
136 T A 0.0000
137 L A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 I A 0.0000
142 S A -0.2301
143 D A -0.7641
144 F A 0.0000
145 Y A 0.0000
146 P A -0.8512
147 G A -0.3104
148 A A -0.2902
149 V A -0.1328
150 T A -0.0069
151 V A 0.5414
152 A A 0.3485
153 W A 0.0000
154 K A -0.4663
155 A A 0.0000
156 D A -1.2869
157 S A -0.7765
158 S A -0.4991
159 P A -0.1185
160 V A 0.7233
161 K A -0.8702
162 A A -0.4016
163 G A -0.2361
164 V A 0.1786
165 E A -0.0032
166 T A 0.0115
167 T A -0.0515
168 T A -0.3539
169 P A -0.7661
170 S A -1.0062
171 K A -1.9591
172 Q A -2.2599
173 S A -1.2966
174 N A -1.4234
175 N A 0.0000
176 K A -1.3488
177 Y A -0.5872
178 A A 0.0000
179 A A -0.1261
180 S A 0.0000
181 S A 0.0000
182 Y A 0.1150
183 L A 0.0000
184 S A -0.3836
185 L A -0.9034
186 T A -1.4759
187 P A 0.0000
188 E A -2.9961
189 Q A -1.7833
190 W A 0.0000
191 K A -2.2916
192 S A -1.8285
193 H A -1.8025
194 R A -1.7598
195 S A -1.1104
196 Y A 0.0000
197 S A -0.2681
198 C A 0.0000
199 Q A -0.4001
200 V A 0.0000
201 T A -0.8623
202 H A 0.0000
203 E A -2.2797
204 G A -1.6905
205 S A -0.7218
206 T A -0.2728
207 V A 0.4350
208 E A -1.4255
209 K A -0.8015
210 T A -0.3152
211 V A 0.1181
212 A A 0.0593
213 P A -0.4927
214 T A -0.7400
215 E A -0.9959
216 C A -0.4028
217 S A -0.6410
218 Q B -1.3855
219 V B -0.6981
220 Q B -1.5718
221 L B 0.0000
222 V B -1.2289
223 Q B 0.0000
224 S B -1.1730
225 G B -0.9968
226 A B 0.0000
227 E B -1.4006
228 V B -0.7641
229 K B 0.0000
230 K B -1.9952
231 P B -2.1699
232 G B -2.0331
233 A B -1.3855
234 S B -1.4001
235 V B -1.1947
236 K B -1.6534
237 V B 0.0000
238 S B -1.1263
239 C B 0.0000
240 K B -1.6984
241 A B 0.0000
242 S B -0.8182
243 G B -0.7228
244 Y B -0.2099
245 T B -0.2459
246 F B 0.0000
247 T B -0.1168
248 N B -0.7056
249 Y B 0.5647
250 Y B 1.0229
251 M B 0.0000
252 H B 0.0000
253 W B 0.0000
254 V B 0.0000
255 R B 0.0000
256 Q B -0.7179
257 A B -0.9898
258 P B -0.9014
259 G B -1.2377
260 Q B -1.8326
261 G B -1.2669
262 L B -0.7509
263 E B -1.0349
264 W B 0.0000
265 V B 0.0000
266 G B 0.0000
267 W B 0.6173
268 I B 0.0000
269 N B 0.0000
270 P B 0.0000
271 Y B 1.0106
272 T B 0.2417
273 G B -0.0688
274 S B 0.1465
275 A B 0.4446
276 F B 1.1451
277 Y B -0.1254
278 A B -1.0748
279 Q B -2.5383
280 K B -3.2226
281 F B 0.0000
282 R B -3.0959
283 G B -2.4398
284 R B -3.2479
285 V B 0.0000
286 T B -1.1568
287 M B 0.0000
288 T B -0.4096
289 R B -0.2219
290 D B -0.6631
291 T B 0.0460
292 S B 0.3858
293 I B 1.2917
294 S B 0.0861
295 T B 0.0000
296 A B 0.0000
297 Y B -0.8047
298 M B 0.0000
299 E B -1.8088
300 L B 0.0000
301 S B -2.1590
302 R B -2.9476
303 L B 0.0000
304 R B -3.6674
305 S B -2.6028
306 D B -2.8413
307 D B -2.1396
308 T B -1.0045
309 A B 0.0000
310 V B 0.1825
311 Y B 0.0000
312 Y B 0.0000
313 C B 0.0000
314 I B 0.0000
315 P B 0.0000
316 I B 1.2631
317 W B 1.7833
318 W B 1.2336
319 V B 0.0000
320 L B 0.0000
321 V B 0.0000
322 G B 0.0000
323 V B 0.3062
324 L B 0.8327
325 G B 0.2819
326 G B 0.6880
327 L B 0.4954
328 W B 0.0000
329 G B 0.0000
330 R B -1.8166
331 G B -0.7304
332 T B -0.4001
333 L B 0.1660
334 V B 0.0000
335 T B -0.7060
336 V B 0.0000
337 S B -1.1990
338 S B -0.9020
339 A B -0.6179
340 S B -0.7864
341 T B -0.8209
342 K B -1.3714
343 G B -1.4795
344 P B -0.7487
345 S B -0.5052
346 V B 0.0000
347 F B 0.0000
348 P B -0.9899
349 L B 0.0000
350 A B -0.9951
351 P B -0.9622
352 S B -1.0362
353 S B -1.5403
354 K B -1.9328
355 S B -1.1715
356 T B -0.9652
357 S B -0.8863
358 G B -0.7768
359 G B -0.7116
360 T B -0.5317
361 A B 0.0000
362 A B -0.0548
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.3942
369 D B -0.7081
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -0.6965
374 P B -0.6408
375 V B -0.6707
376 T B -0.4100
377 V B -0.2205
378 S B -0.2445
379 W B 0.0000
380 N B -0.6597
381 S B -0.5852
382 G B -0.3680
383 A B -0.1419
384 L B 0.0535
385 T B -0.0872
386 S B -0.1238
387 G B -0.0690
388 V B 0.3289
389 H B 0.0000
390 T B 0.0817
391 F B 0.0000
392 P B 0.1385
393 A B 0.4431
394 V B 1.0150
395 L B 1.3611
396 Q B 0.2044
397 S B -0.0856
398 S B -0.2296
399 G B 0.1152
400 L B 0.1716
401 Y B 0.3882
402 S B 0.2144
403 L B 0.3050
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0844
409 V B 0.0000
410 P B -0.5744
411 S B -0.6243
412 S B -0.6740
413 S B -0.7875
414 L B -0.9141
415 G B -1.1807
416 T B -0.9218
417 Q B -1.3388
418 T B -1.2506
419 Y B 0.0000
420 I B -1.2776
421 C B 0.0000
422 N B -1.3601
423 V B 0.0000
424 N B 0.0000
425 H B 0.0000
426 K B -2.3500
427 P B -1.6907
428 S B -1.7622
429 N B -2.3498
430 T B -1.9921
431 K B -2.4278
432 V B -1.6290
433 D B -2.4674
434 K B -2.0562
435 K B -2.4623
436 V B 0.0000
437 E B -2.8208
438 P B -2.2254
439 K B -2.4025
440 S B -1.7474
441 C B -1.5388
442 D B -2.5721
443 K B -2.1401
444 T B -1.3888
445 H B -1.5268
446 T B -1.4011
447 C B 0.0000
448 P B -1.0554
449 P B -0.4927
450 C B -0.4220
451 P B -0.6067
452 A B -0.7970
453 P B -0.7670
454 E B -1.2273
455 L B -0.0628
456 L B 1.1098
457 G B 0.1498
458 G B -0.2953
459 P B 0.0000
460 S B -0.2069
461 V B 0.0000
462 F B 0.9312
463 L B 0.0000
464 F B 1.4047
465 P B 0.1911
466 P B 0.0000
467 K B -1.8818
468 P B -1.3911
469 K B -1.5822
470 D B -1.5839
471 T B 0.0000
472 L B 0.0000
473 M B 0.4072
474 I B 1.4509
475 S B -0.0794
476 R B -1.5109
477 T B -0.7503
478 P B 0.0000
479 E B -1.3245
480 V B 0.0000
481 T B 0.5905
482 C B 0.0000
483 V B 0.0000
484 V B 0.0000
485 V B -0.4830
486 D B -1.2802
487 V B 0.0000
488 S B -2.0102
489 H B -2.2837
490 E B -2.9137
491 D B -2.5336
492 P B -2.6397
493 E B -3.1353
494 V B 0.0000
495 K B -2.5334
496 F B 0.0000
497 N B -1.2340
498 W B 0.0000
499 Y B -0.9391
500 V B -0.6913
501 D B -1.9627
502 G B -0.6222
503 V B 0.9489
504 E B -0.0933
505 V B 0.4265
506 H B -1.1037
507 N B -1.0073
508 A B -1.0421
509 K B -1.9333
510 T B -1.1447
511 K B -1.7677
512 P B -1.6361
513 R B -2.9152
514 E B -3.5231
515 E B -3.3585
516 Q B -2.5938
517 Y B -1.2416
518 N B -1.3483
519 S B -1.0982
520 T B -1.6327
521 Y B -2.3926
522 R B -2.2258
523 V B 0.0000
524 V B -0.6443
525 S B 0.0000
526 V B 0.0218
527 L B 0.0000
528 T B -0.5213
529 V B 0.2593
530 L B 0.8724
531 H B -0.1650
532 Q B -1.2682
533 D B -1.0772
534 W B 0.0000
535 L B -0.8861
536 N B -1.9969
537 G B -2.0956
538 K B -2.1514
539 E B -2.2373
540 Y B 0.0000
541 K B -1.9939
542 C B 0.0000
543 K B -1.8428
544 V B 0.0000
545 S B -1.5117
546 N B -1.9182
547 K B -2.0931
548 A B -1.2460
549 L B -0.5572
550 P B -0.4194
551 A B -0.3587
552 P B -0.5522
553 I B -0.6010
554 E B -1.8779
555 K B -2.0224
556 T B -1.5094
557 I B -0.3138
558 S B -1.5523
559 K B -1.3683
560 A B -1.3007
561 K B -2.3304
562 G B -2.1020
563 Q B -2.3230
564 P B -2.2037
565 R B -2.6690
566 E B -2.5299
567 P B 0.0000
568 Q B -1.1704
569 V B 0.0000
570 Y B 0.0000
571 T B -0.6758
572 L B -0.3186
573 P B -0.1411
574 P B 0.0000
575 S B -1.4093
576 R B -2.6677
577 E B -2.8748
578 E B 0.0000
579 M B -1.6616
580 T B -1.6860
581 K B -2.6486
582 N B -2.7997
583 Q B -2.6694
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B 0.0000
592 G B -1.0206
593 F B 0.0000
594 Y B -1.3171
595 P B 0.0000
596 S B -0.0422
597 D B -0.9009
598 I B 0.0000
599 A B -0.5929
600 V B 0.0000
601 E B -1.5066
602 W B 0.0000
603 E B -1.9327
604 S B 0.0000
605 N B -2.0649
606 G B -1.8573
607 Q B -2.2473
608 P B -2.0588
609 E B -2.2323
610 N B -2.0412
611 N B -1.4871
612 Y B -1.0921
613 K B -0.9305
614 T B -0.5411
615 T B 0.0000
616 P B -0.0344
617 P B 0.2309
618 V B 0.5959
619 L B 0.6687
620 D B -0.5644
621 S B -1.4244
622 D B -2.0302
623 G B -0.9515
624 S B 0.0000
625 F B 0.0905
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9183
633 V B 0.0000
634 D B -2.4185
635 K B -2.4312
636 S B -1.9633
637 R B -2.0535
638 W B -1.8061
639 Q B -2.3781
640 Q B -2.2822
641 G B -1.3501
642 N B -1.3314
643 V B -0.3013
644 F B 0.0000
645 S B 0.0000
646 C B 0.0000
647 S B -0.7621
648 V B 0.0000
649 M B -0.4966
650 H B 0.0000
651 E B -1.0007
652 A B -1.7060
653 L B 0.0000
654 H B -1.5995
655 N B -1.5215
656 H B -0.9150
657 Y B 0.0324
658 T B -0.6951
659 Q B -1.1588
660 K B -0.8588
661 S B -0.1351
662 L B 0.0000
663 S B 0.3004
664 L B 1.3087
665 S B 0.2731
666 P B -0.0362
667 G B -0.8708
668 Q C -1.4187
669 A C -0.2625
670 V C 0.0000
671 L C 1.0513
672 T C -0.1666
673 Q C -1.0805
674 P C -0.9094
675 P C -0.9398
676 S C -0.9544
677 V C -0.2654
678 S C -0.0382
679 G C 0.0000
680 A C -0.9161
681 P C -1.3446
682 G C -1.7449
683 Q C -2.4694
684 R C -2.8120
685 V C 0.0000
686 T C -0.7935
687 I C 0.0000
688 S C -0.4167
689 C C 0.0000
690 T C -0.0417
691 G C -0.1764
692 S C -0.5199
693 S C -0.6652
694 S C -0.2787
695 N C -0.2329
696 I C 1.4040
697 G C 0.0000
698 A C 0.0000
699 G C 0.3426
700 Y C 1.2494
701 G C 0.0000
702 V C 0.0000
703 H C 0.0000
704 W C 0.0000
705 Y C 0.0000
706 Q C 0.0000
707 Q C 0.0000
708 L C -0.4146
709 P C -0.6103
710 G C -0.5148
711 T C -0.6168
712 A C -0.3708
713 P C 0.0000
714 K C -0.1266
715 L C 0.0000
716 L C 0.0000
717 I C 0.0000
718 Y C -0.1943
719 G C 0.0000
720 D C -1.4505
721 S C -1.5400
722 N C -1.8693
723 R C -1.9423
724 P C 0.0000
725 S C -0.8008
726 G C -0.9105
727 V C -1.1815
728 P C -1.9488
729 D C -2.9099
730 R C -2.9958
731 F C 0.0000
732 S C -1.5286
733 G C 0.0000
734 S C -1.0580
735 K C -0.7094
736 S C -0.2229
737 G C 0.0675
738 T C -0.2197
739 S C -0.1578
740 A C 0.0000
741 S C -0.6722
742 L C 0.0000
743 A C -0.8047
744 I C 0.0000
745 T C -2.2186
746 G C 0.0000
747 L C 0.0000
748 Q C -1.7003
749 A C -1.6310
750 E C -2.1530
751 D C 0.0000
752 E C 0.0000
753 A C 0.0000
754 D C -0.9293
755 Y C 0.0000
756 Y C 0.0000
757 C C 0.0000
758 Q C 0.0000
759 S C 0.0000
760 Y C -0.2321
761 D C -1.4038
762 N C -1.6478
763 S C 0.0000
764 L C 0.9723
765 S C -0.0067
766 G C 0.0000
767 Y C 0.0000
768 V C -0.1484
769 F C 0.0000
770 G C 0.0000
771 G C -0.6085
772 G C -0.8968
773 T C 0.0000
774 Q C -1.4668
775 L C 0.0000
776 T C -0.1264
777 V C 0.0000
778 L C 0.2828
779 G C -0.4775
780 Q C -1.2137
781 P C -1.3377
782 K C -2.2134
783 A C -1.4095
784 A C -0.9521
785 P C 0.0000
786 S C -0.3453
787 V C -0.0537
788 T C 0.1377
789 L C 0.0000
790 F C 0.0000
791 P C 0.0000
792 P C 0.0000
793 S C 0.0000
794 S C -1.3515
795 E C -2.3149
796 E C 0.0000
797 L C -2.1223
798 Q C -2.2278
799 A C -1.7270
800 N C -2.5974
801 K C -2.2260
802 A C 0.0000
803 T C 0.0000
804 L C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 I C 0.0000
809 S C 0.0000
810 D C -1.0018
811 F C 0.0000
812 Y C 0.0000
813 P C -0.8588
814 G C -0.3200
815 A C -0.3000
816 V C -0.1014
817 T C -0.1217
818 V C 0.4860
819 A C 0.3498
820 W C 0.0000
821 K C -0.4649
822 A C 0.0000
823 D C -1.4114
824 S C -0.8567
825 S C -0.4883
826 P C -0.1197
827 V C 0.7422
828 K C -0.8607
829 A C -0.3573
830 G C -0.3139
831 V C 0.2913
832 E C 0.0306
833 T C 0.0749
834 T C -0.0181
835 T C -0.2894
836 P C -0.7002
837 S C -0.9488
838 K C -1.8864
839 Q C -2.3206
840 S C -1.4153
841 N C -1.7010
842 N C -1.5029
843 K C -1.3633
844 Y C -0.5801
845 A C 0.0000
846 A C -0.1453
847 S C 0.0000
848 S C 0.0000
849 Y C 0.0000
850 L C 0.0000
851 S C -0.3795
852 L C -0.9105
853 T C -1.6512
854 P C 0.0000
855 E C -3.1239
856 Q C -2.3335
857 W C 0.0000
858 K C -3.0665
859 S C -2.2737
860 H C -2.4893
861 R C -2.6554
862 S C -1.4060
863 Y C 0.0000
864 S C -0.3113
865 C C 0.0000
866 Q C -0.3223
867 V C 0.0000
868 T C -0.6388
869 H C 0.0000
870 E C -2.0492
871 G C -1.3115
872 S C -0.5471
873 T C -0.0938
874 V C 0.7233
875 E C -0.9094
876 K C -0.8574
877 T C -0.2923
878 V C 0.2671
879 A C 0.1101
880 P C 0.0000
881 T C -0.8399
882 E C -1.0271
883 C C -0.2919
884 S C -0.5274
885 Q D -1.0955
886 V D -0.3442
887 Q D -0.9103
888 L D 0.0000
889 V D -0.8712
890 Q D 0.0000
891 S D -1.1606
892 G D -1.0806
893 A D 0.0000
894 E D -1.6889
895 V D -1.2048
896 K D -1.7540
897 K D -2.3587
898 P D -2.3937
899 G D -2.3159
900 A D -1.6464
901 S D -1.7159
902 V D -1.6255
903 K D -2.0599
904 V D 0.0000
905 S D -1.1398
906 C D 0.0000
907 K D -1.5467
908 A D -0.7721
909 S D -0.6930
910 G D -0.6940
911 Y D -0.2131
912 T D -0.2962
913 F D 0.0000
914 T D -0.1526
915 N D -0.8207
916 Y D 0.3083
917 Y D 0.7600
918 M D 0.0000
919 H D 0.0000
920 W D 0.0000
921 V D 0.0000
922 R D 0.0000
923 Q D -0.7659
924 A D -1.0190
925 P D -0.8762
926 G D -1.2160
927 Q D -1.8173
928 G D -1.2373
929 L D 0.0000
930 E D -1.2435
931 W D 0.0000
932 V D 0.0000
933 G D 0.0000
934 W D 0.4160
935 I D 0.0000
936 N D 0.1932
937 P D 0.2606
938 Y D 0.8384
939 T D 0.1774
940 G D -0.1896
941 S D -0.0437
942 A D 0.1459
943 F D 0.7060
944 Y D -0.2997
945 A D -1.1853
946 Q D -2.6933
947 K D -3.5274
948 F D 0.0000
949 R D -3.2628
950 G D -2.5715
951 R D -3.4812
952 V D 0.0000
953 T D -1.2854
954 M D 0.0000
955 T D -0.3985
956 R D -0.1264
957 D D -0.2265
958 T D 0.1564
959 S D 0.4711
960 I D 1.3713
961 S D 0.1676
962 T D 0.0000
963 A D 0.0000
964 Y D -0.8606
965 M D 0.0000
966 E D -2.0919
967 L D 0.0000
968 S D -2.2999
969 R D -3.0958
970 L D 0.0000
971 R D -3.7061
972 S D -2.6208
973 D D -2.7499
974 D D 0.0000
975 T D -1.0312
976 A D 0.0000
977 V D 0.0207
978 Y D 0.0000
979 Y D 0.0000
980 C D 0.0000
981 I D 0.0000
982 P D 0.0000
983 I D 1.1385
984 W D 1.7979
985 W D 1.2212
986 V D 0.0000
987 L D 0.0000
988 V D 0.0000
989 G D 0.0000
990 V D 0.1969
991 L D 0.9749
992 G D 0.1445
993 G D 0.0000
994 L D 0.6338
995 W D 0.0000
996 G D 0.0000
997 R D -1.5831
998 G D -0.7600
999 T D -0.4937
1000 L D 0.1071
1001 V D 0.0000
1002 T D -0.9278
1003 V D 0.0000
1004 S D -1.3578
1005 S D -1.0460
1006 A D -0.7136
1007 S D -0.8156
1008 T D -0.7266
1009 K D -1.1937
1010 G D -1.2562
1011 P D -0.5736
1012 S D -0.5136
1013 V D 0.0000
1014 F D -0.5833
1015 P D -1.1704
1016 L D 0.0000
1017 A D 0.0000
1018 P D -0.7702
1019 S D -0.7569
1020 S D -1.2343
1021 K D -2.0042
1022 S D -1.2600
1023 T D -0.9868
1024 S D -0.8806
1025 G D -0.7687
1026 G D -0.6935
1027 T D -0.5307
1028 A D -0.3646
1029 A D -0.0624
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.3193
1036 D D -0.5651
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.9010
1041 P D -0.7906
1042 V D -0.6262
1043 T D -0.4942
1044 V D -0.0690
1045 S D -0.3138
1046 W D 0.0000
1047 N D -0.8045
1048 S D -0.6569
1049 G D -0.4263
1050 A D -0.2017
1051 L D -0.0257
1052 T D -0.1261
1053 S D -0.1328
1054 G D -0.0921
1055 V D 0.2991
1056 H D 0.0000
1057 T D 0.0793
1058 F D 0.0000
1059 P D 0.1769
1060 A D 0.4002
1061 V D 0.9372
1062 L D 1.0160
1063 Q D -0.4705
1064 S D -0.4137
1065 S D -0.4195
1066 G D 0.0000
1067 L D -0.0184
1068 Y D 0.2479
1069 S D 0.0000
1070 L D 0.3356
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0769
1076 V D 0.0000
1077 P D -0.5954
1078 S D -0.6291
1079 S D -0.7108
1080 S D -0.8583
1081 L D 0.0000
1082 G D -1.2714
1083 T D -0.9680
1084 Q D -1.4321
1085 T D -1.3868
1086 Y D 0.0000
1087 I D -1.3736
1088 C D 0.0000
1089 N D -1.4347
1090 V D 0.0000
1091 N D -1.8329
1092 H D 0.0000
1093 K D -2.6808
1094 P D -1.8376
1095 S D -1.8074
1096 N D -2.4694
1097 T D -2.0638
1098 K D -2.5843
1099 V D -1.6963
1100 D D -2.5430
1101 K D -2.1287
1102 K D -2.7474
1103 V D 0.0000
1104 E D -2.6556
1105 P D -1.5921
1106 K D -1.0818
1107 S D -1.0409
1108 C D -0.8090
1109 D D -2.6293
1110 K D -2.8654
1111 T D -1.6195
1112 H D -1.1160
1113 T D 0.0000
1114 C D 0.0000
1115 P D -1.1425
1116 P D -0.5986
1117 C D -0.3410
1118 P D -0.7414
1119 A D 0.0000
1120 P D -0.9628
1121 E D -1.3471
1122 L D 0.0748
1123 L D 1.0804
1124 G D 0.0186
1125 G D -0.0698
1126 P D -0.1035
1127 S D 0.2332
1128 V D 0.0000
1129 F D 2.0242
1130 L D 0.0000
1131 F D 2.0218
1132 P D 0.4503
1133 P D 0.0000
1134 K D -1.8647
1135 P D -1.2246
1136 K D -0.9181
1137 D D 0.0000
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.5874
1141 I D 1.4946
1142 S D 0.0601
1143 R D -1.0780
1144 T D -0.6093
1145 P D 0.0000
1146 E D -0.9937
1147 V D 0.0000
1148 T D 0.8823
1149 C D 0.0000
1150 V D 0.8200
1151 V D 0.0000
1152 V D 0.4013
1153 D D -0.1279
1154 V D 0.0000
1155 S D -1.7688
1156 H D -2.1810
1157 E D -2.8959
1158 D D -2.3044
1159 P D -2.3655
1160 E D -2.6726
1161 V D 0.0000
1162 K D -2.4445
1163 F D 0.0000
1164 N D -1.2022
1165 W D 0.0000
1166 Y D -0.7787
1167 V D -0.7141
1168 D D -1.7835
1169 G D -0.5516
1170 V D 1.0503
1171 E D 0.0114
1172 V D 0.4554
1173 H D -1.0596
1174 N D -1.0114
1175 A D -1.0966
1176 K D -2.0180
1177 T D -1.3490
1178 K D -1.8172
1179 P D -1.7884
1180 R D -2.2360
1181 E D -2.8131
1182 E D -3.0103
1183 Q D -1.8514
1184 Y D -0.6766
1185 N D -0.6908
1186 S D -0.9083
1187 T D -1.0401
1188 Y D -1.5646
1189 R D -1.5989
1190 V D 0.0000
1191 V D -0.5575
1192 S D 0.0000
1193 V D -0.0534
1194 L D 0.0000
1195 T D -0.3970
1196 V D 0.2701
1197 L D 0.7739
1198 H D -0.1890
1199 Q D -1.1145
1200 D D -1.2865
1201 W D 0.0000
1202 L D -0.9777
1203 N D -2.0304
1204 G D -2.0208
1205 K D -2.1626
1206 E D -2.4329
1207 Y D 0.0000
1208 K D -1.7292
1209 C D 0.0000
1210 K D -1.6507
1211 V D 0.0000
1212 S D -1.4551
1213 N D -1.8737
1214 K D -2.0993
1215 A D -1.3029
1216 L D -0.6249
1217 P D -0.4997
1218 A D -0.3684
1219 P D -0.5573
1220 I D -0.5536
1221 E D -1.5305
1222 K D -1.1466
1223 T D -1.0803
1224 I D -0.1120
1225 S D -1.6442
1226 K D -1.5404
1227 A D -1.3588
1228 K D -2.3547
1229 G D -2.1424
1230 Q D -2.2320
1231 P D -2.1785
1232 R D -2.6839
1233 E D -2.1915
1234 P D 0.0000
1235 Q D -1.2733
1236 V D 0.0000
1237 Y D 0.0000
1238 T D -0.6005
1239 L D -0.0977
1240 P D -0.2273
1241 P D 0.0000
1242 S D -1.4524
1243 R D -2.7244
1244 E D -2.8546
1245 E D 0.0000
1246 M D -1.6980
1247 T D -1.5839
1248 K D -2.4119
1249 N D -2.6987
1250 Q D -2.6379
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D -0.5781
1259 G D -1.0445
1260 F D 0.0000
1261 Y D -1.2284
1262 P D 0.0000
1263 S D -0.0407
1264 D D -0.9082
1265 I D 0.0000
1266 A D -0.4556
1267 V D -0.3268
1268 E D -1.0569
1269 W D 0.0000
1270 E D -1.9051
1271 S D 0.0000
1272 N D -2.0505
1273 G D -1.8967
1274 Q D -2.2320
1275 P D -1.9655
1276 E D -2.2066
1277 N D -2.1503
1278 N D -1.8274
1279 Y D -1.1727
1280 K D -0.9589
1281 T D -0.4945
1282 T D 0.0000
1283 P D -0.0545
1284 P D 0.1847
1285 V D 0.6020
1286 L D 0.7595
1287 D D -0.4721
1288 S D -1.2860
1289 D D -1.9510
1290 G D -0.8813
1291 S D -0.7502
1292 F D 0.0654
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D 0.0000
1300 V D 0.0000
1301 D D -2.5040
1302 K D -2.3687
1303 S D -1.9661
1304 R D -2.0635
1305 W D -1.7787
1306 Q D -2.3602
1307 Q D -2.3237
1308 G D -1.3182
1309 N D -1.1535
1310 V D -0.3312
1311 F D 0.0000
1312 S D -0.9924
1313 C D 0.0000
1314 S D -0.6682
1315 V D 0.0000
1316 M D 0.0000
1317 H D 0.0000
1318 E D -1.1325
1319 A D -1.7207
1320 L D 0.0000
1321 H D -1.7760
1322 N D -1.8115
1323 H D -1.2440
1324 Y D -0.7096
1325 T D -0.9566
1326 Q D -1.0673
1327 K D -0.9461
1328 S D -0.2330
1329 L D 0.3667
1330 S D 0.2435
1331 L D 1.3423
1332 S D 0.2600
1333 P D -0.5820
1334 G D -0.7109

 

Laboratory of Theory of Biopolymers 2015