Project name: DENV1 EDIII

Status: done

submitted: 2018-07-04 00:23:01, status changed: 2018-07-04 00:28:04
Settings
Chain sequence(s) E: MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGATQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2081
Maximal score value
2.116
Average score
-1.0792
Total score value
-105.7633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
297 M E 1.0739
298 S E 0.8686
299 Y E 1.5229
300 V E 2.1160
301 M E 1.4782
302 C E 0.0000
303 T E -0.3639
304 G E -1.0442
305 S E -1.8602
306 F E 0.0000
307 K E -2.8112
308 L E -2.1180
309 E E -2.9294
310 K E -3.2503
311 E E -2.8256
312 V E -1.4510
313 A E -1.3836
314 E E -2.4456
315 T E -1.7998
316 Q E -2.1227
317 H E -2.0181
318 G E -1.7056
319 T E -1.4608
320 V E 0.0000
321 L E -0.9260
322 V E 0.0000
323 Q E -2.1915
324 V E 0.0000
325 K E -3.7302
326 Y E 0.0000
327 E E -3.1923
328 G E -1.6995
329 T E -1.2134
330 D E -0.9940
331 A E -0.9071
332 P E -0.3174
333 C E 0.0000
334 K E 0.2556
335 I E 0.0000
336 P E 0.1872
337 F E -0.0073
338 S E -0.8078
339 T E 0.0000
340 Q E -2.1024
341 D E -2.5047
342 E E -3.3949
343 K E -2.8443
344 G E -1.9379
345 A E -1.3908
346 T E -1.4198
347 Q E -2.0164
348 N E -2.1796
349 G E -2.1962
350 R E -2.3123
351 L E -0.6446
352 I E 0.5604
353 T E -0.1781
354 A E -0.1434
355 N E -1.0284
356 P E -0.5515
357 I E 0.0637
358 V E 0.0000
359 T E -1.3295
360 D E -2.7170
361 K E -4.2081
362 E E -4.1106
363 K E -3.7087
364 P E -2.9974
365 V E -1.6962
366 N E -1.6729
367 I E 0.0000
368 E E -0.6371
369 A E 0.0000
370 E E -1.4493
371 P E 0.0000
372 P E -0.2731
373 F E 1.1857
374 G E -0.0670
375 E E -1.3715
376 S E 0.0000
377 Y E -1.0154
378 I E 0.0000
379 V E 0.0000
380 V E 0.0000
381 G E 0.0000
382 A E -0.9143
383 G E -1.7677
384 E E -2.6627
385 K E -2.5524
386 A E -1.8569
387 L E -1.4204
388 K E -1.7223
389 L E -0.4032
390 S E -0.5185
391 W E 0.5888
392 F E 1.1885
393 K E -0.2026
394 K E -1.1562

 

Laboratory of Theory of Biopolymers 2015