Project name: 2165939432f78e8

Status: done

submitted: 2017-12-06 11:48:46, status changed: 2017-12-06 12:27:06
Settings
Chain sequence(s) A: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCTIAALLSPYSYSWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCTIAALLSPYSYSWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.274
Maximal score value
2.1643
Average score
-0.7467
Total score value
-994.6032

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.4749
2 V A -0.0987
3 Q A -0.3560
4 L A 0.0000
5 V A 0.7282
6 E A 0.0000
7 S A -0.0954
8 G A -0.0187
9 G A -0.0193
10 G A 0.1009
11 V A 0.5738
12 V A -0.5080
13 Q A -1.4662
14 P A -2.3074
15 G A -2.3890
16 R A -2.7823
17 S A -2.4908
18 L A -1.4723
19 R A -2.0481
20 L A 0.0000
21 S A -0.4233
22 C A 0.0000
23 S A -0.6090
24 A A 0.0000
25 S A -0.5483
26 G A -0.7125
27 F A 0.0406
28 T A 0.0045
29 F A 0.0000
30 S A -0.6111
31 G A 0.0191
32 Y A 0.9085
33 G A 0.4425
34 L A 0.0000
35 S A 0.3109
36 W A 0.0000
37 V A 0.0000
38 R A -0.8841
39 Q A -1.2429
40 A A -1.5474
41 P A -1.3078
42 G A -1.6241
43 K A -2.5555
44 G A -1.8911
45 L A 0.0000
46 E A -1.5052
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 M A 0.8818
51 I A 0.0000
52 S A 0.3640
53 S A 0.0000
54 G A -0.6710
55 G A -0.2310
56 S A 0.0466
57 Y A 1.2867
58 T A 1.0403
59 Y A 1.3357
60 Y A -0.3080
61 A A -1.1043
62 D A -2.3414
63 S A -1.8654
64 V A 0.0000
65 K A -2.4926
66 G A -2.1103
67 R A -2.1256
68 F A -1.4001
69 A A -0.9562
70 I A 0.0000
71 S A -0.6611
72 R A -1.4226
73 D A -1.8889
74 N A -2.2129
75 A A -1.6357
76 K A -2.4623
77 N A -2.0282
78 T A 0.0000
79 L A 0.0000
80 F A -0.6933
81 L A 0.0000
82 Q A -1.3909
83 M A 0.0000
84 D A -2.6780
85 S A -2.1698
86 L A 0.0000
87 R A -3.3542
88 P A -2.2817
89 E A -2.6541
90 D A -1.9535
91 T A -1.0124
92 G A 0.0000
93 V A 0.0081
94 Y A 0.0000
95 F A 0.0000
96 C A 0.0000
97 T A 0.1769
98 I A 0.0000
99 A A 0.0000
100 A A 0.0000
101 L A 1.0493
102 L A 1.2330
103 S A 0.3183
104 P A -0.2833
105 Y A -0.4412
106 S A -0.1812
107 Y A 0.2388
108 S A 0.0568
109 W A 0.0000
110 G A 0.0000
111 Q A 0.0000
112 G A 0.0000
113 T A 0.0000
114 P A 0.2248
115 V A 0.0000
116 T A -0.3886
117 V A 0.0000
118 S A -1.0679
119 S A -0.6749
120 A A -0.4304
121 S A -0.5237
122 T A -0.8254
123 K A -1.7812
124 G A -1.7804
125 P A -1.0642
126 S A -0.4483
127 V A 0.0000
128 F A -0.5578
129 P A -1.0595
130 L A 0.0000
131 A A -0.9328
132 P A 0.0000
133 S A -1.0552
134 S A -1.0867
135 K A -1.9012
136 S A -1.3596
137 T A -1.1094
138 S A -0.9008
139 G A -0.8628
140 G A -0.9063
141 T A -0.7712
142 A A -0.5093
143 A A 0.0000
144 L A 0.0000
145 G A 0.0000
146 C A 0.0000
147 L A 0.0000
148 V A 0.0000
149 K A 0.0000
150 D A -1.4412
151 Y A 0.0000
152 F A 0.0000
153 P A -1.0540
154 E A -1.3749
155 P A -1.1262
156 V A -0.8367
157 T A -0.6088
158 V A -0.1882
159 S A -0.4299
160 W A 0.0000
161 N A -0.7039
162 S A -0.6813
163 G A -0.5751
164 A A -0.2512
165 L A -0.0098
166 T A -0.1941
167 S A -0.1688
168 G A -0.1560
169 V A 0.0895
170 H A -0.1408
171 T A 0.0209
172 F A 0.0000
173 P A -0.3704
174 A A -0.0675
175 V A 0.1455
176 L A 0.4138
177 Q A -0.2027
178 S A -0.2076
179 S A -0.4809
180 G A -0.3118
181 L A 0.0000
182 Y A -0.1583
183 S A 0.0000
184 L A 0.0000
185 S A 0.0000
186 S A 0.0000
187 V A 0.0000
188 V A 0.0000
189 T A -0.1166
190 V A 0.0000
191 P A -0.5429
192 S A -0.6448
193 S A -0.5555
194 S A -0.7009
195 L A -0.8768
196 G A -1.0705
197 T A -0.8916
198 Q A -1.5520
199 T A -1.2493
200 Y A 0.0000
201 I A -1.2698
202 C A 0.0000
203 N A -1.4493
204 V A 0.0000
205 N A -1.7884
206 H A 0.0000
207 K A -2.8688
208 P A -1.8830
209 S A -2.0639
210 N A -2.6552
211 T A -2.0860
212 K A -2.5592
213 V A -1.3214
214 D A -2.4013
215 K A -1.8803
216 K A -2.2903
217 V A 0.0000
218 E A -2.6853
219 P A -1.6571
220 K A -1.7261
221 S A -1.5133
222 C A -1.4228
223 D A -2.7944
224 K A -3.2963
225 T A -2.2090
226 H A -2.4105
227 T A -1.5059
228 C A -0.0662
229 P A -0.3770
230 P A 0.0640
231 C A 0.4834
232 P A -0.1603
233 A A -0.9465
234 P A -1.0577
235 E A -1.3530
236 L A 1.2176
237 L A 1.4902
238 G A 0.2622
239 G A -0.2134
240 P A 0.0000
241 S A 0.0188
242 V A 0.0000
243 F A 1.0644
244 L A 0.9036
245 F A 1.3282
246 P A -0.0377
247 P A 0.0000
248 K A -2.1516
249 P A -1.2653
250 K A -0.9979
251 D A 0.0000
252 T A 0.0000
253 L A -0.1742
254 M A 0.4178
255 I A 1.3362
256 S A -0.1153
257 R A -1.6488
258 T A -0.8676
259 P A 0.0000
260 E A -1.1335
261 V A 0.0000
262 T A 0.5488
263 C A 0.0000
264 V A 0.0000
265 V A 0.0000
266 V A -0.8642
267 D A -1.2251
268 V A 0.0000
269 S A -1.6266
270 H A -2.0942
271 E A -2.7453
272 D A -2.1652
273 P A -2.2253
274 E A -2.8738
275 V A -1.8673
276 K A -2.2029
277 F A -1.3294
278 N A -1.4879
279 W A 0.0000
280 Y A -1.3409
281 V A -1.1278
282 D A -2.2812
283 G A -0.9831
284 V A 0.3155
285 E A -1.4761
286 V A -0.9318
287 H A -2.0808
288 N A -2.2136
289 A A -1.6394
290 K A -2.3764
291 T A -1.8055
292 K A -2.3840
293 P A -2.3434
294 R A -3.7806
295 E A -4.2740
296 E A -3.7604
297 Q A -2.5817
298 Y A -0.1940
299 N A -1.2898
300 S A -1.2485
301 T A -1.9141
302 Y A -2.9335
303 R A -3.3799
304 V A 0.0000
305 V A 0.0000
306 S A 0.0000
307 V A -0.6288
308 L A 0.0000
309 T A -0.6648
310 V A 0.0000
311 L A 0.1149
312 H A -0.5337
313 Q A -1.4852
314 D A -1.5605
315 W A 0.0000
316 L A -0.9871
317 N A -2.0620
318 G A -2.0387
319 K A -2.1041
320 E A -2.5033
321 Y A 0.0000
322 K A -1.9066
323 C A 0.0000
324 K A -1.9126
325 V A 0.0000
326 S A -1.4783
327 N A -1.6763
328 K A -2.4858
329 A A -1.5663
330 L A -0.5234
331 P A -0.4624
332 A A -0.5480
333 P A -0.8890
334 I A -0.8080
335 E A -2.3004
336 K A -1.5519
337 T A -1.2491
338 I A -0.3461
339 S A -1.1751
340 K A -1.2623
341 A A -0.9700
342 K A -2.1993
343 G A -1.8086
344 Q A -2.0044
345 P A -2.1457
346 R A -2.5678
347 E A -2.7826
348 P A 0.0000
349 Q A -1.2984
350 V A 0.0000
351 Y A 0.0000
352 T A -0.6691
353 L A 0.0000
354 P A -0.3401
355 P A -0.7867
356 S A 0.0000
357 R A -2.5332
358 D A -2.3601
359 E A 0.0000
360 L A -1.6021
361 T A -1.4927
362 K A -2.2805
363 N A -2.4810
364 Q A -2.3268
365 V A 0.0000
366 S A 0.0000
367 L A 0.0000
368 T A 0.0000
369 C A 0.0000
370 L A 0.0000
371 V A 0.0000
372 K A -0.4965
373 G A -1.1024
374 F A 0.0000
375 Y A -1.1171
376 P A 0.0000
377 S A -0.1853
378 D A -0.9468
379 I A -0.5337
380 A A -0.4742
381 V A 0.0000
382 E A -1.1084
383 W A 0.0000
384 E A -1.5773
385 S A 0.0000
386 N A -1.7510
387 G A -1.8542
388 Q A -2.2671
389 P A -1.8803
390 E A 0.0000
391 N A -2.0651
392 N A -1.5936
393 Y A -1.0604
394 K A -1.1141
395 T A -0.4349
396 T A 0.0000
397 P A -0.0732
398 P A 0.2189
399 V A 0.7082
400 L A 1.0987
401 D A -0.3016
402 S A -1.0733
403 D A -1.7891
404 G A -0.8011
405 S A 0.0000
406 F A 0.2517
407 F A 0.0000
408 L A 0.0000
409 Y A 0.0000
410 S A 0.0000
411 K A 0.0000
412 L A 0.0000
413 T A -0.9383
414 V A 0.0000
415 D A -2.3929
416 K A -2.2767
417 S A -1.8675
418 R A -1.5881
419 W A 0.0000
420 Q A -1.7434
421 Q A -1.9192
422 G A -1.1734
423 N A -0.4261
424 V A 0.8937
425 F A 0.0000
426 S A -0.6069
427 C A 0.0000
428 S A 0.0000
429 V A 0.0000
430 M A 0.0000
431 H A 0.0000
432 E A -1.1134
433 A A -1.7784
434 L A 0.0000
435 H A -1.9211
436 N A -1.7889
437 H A -1.3136
438 Y A -0.5241
439 T A -0.8140
440 Q A -1.1673
441 K A -1.0344
442 S A -0.3484
443 L A 0.0000
444 S A 0.1858
445 L A -0.4020
446 S A -0.8936
447 P A -1.0054
448 G A -1.4537
449 K A -2.3693
450 E B -1.9859
451 V B -0.8375
452 Q B -0.8677
453 L B 0.0000
454 V B 1.2487
455 E B 0.2541
456 S B -0.5123
457 G B -0.6814
458 G B -0.5591
459 G B -0.0275
460 V B 0.9906
461 V B 0.0101
462 Q B -0.8917
463 P B -1.9966
464 G B -2.1168
465 R B -2.4438
466 S B -2.1953
467 L B -1.4739
468 R B -2.2436
469 L B 0.0000
470 S B -0.4728
471 C B 0.0000
472 S B -0.3844
473 A B 0.0000
474 S B -0.7171
475 G B -1.0797
476 F B -0.3501
477 T B -0.1406
478 F B 0.0000
479 S B -0.3915
480 G B 0.4313
481 Y B 1.0385
482 G B 0.0000
483 L B 0.0000
484 S B 0.0000
485 W B 0.0000
486 V B 0.0000
487 R B -0.5450
488 Q B -0.8968
489 A B -1.3459
490 P B -1.2367
491 G B -1.6108
492 K B -2.4338
493 G B -1.6591
494 L B 0.0000
495 E B -0.8070
496 W B -0.0311
497 V B 0.0000
498 A B 0.0000
499 M B 0.0000
500 I B 0.0000
501 S B 0.0000
502 S B 0.0000
503 G B -0.3625
504 G B -0.0292
505 S B -0.1339
506 Y B 0.8131
507 T B 0.6000
508 Y B 0.2602
509 Y B -0.4583
510 A B -1.1238
511 D B -2.2755
512 S B -1.6412
513 V B -1.5409
514 K B -2.5228
515 G B -1.9297
516 R B -1.7927
517 F B 0.0000
518 A B -0.9915
519 I B -0.1360
520 S B -0.4845
521 R B -1.4830
522 D B -2.0131
523 N B -2.1846
524 A B -1.6595
525 K B -2.6046
526 N B -2.1264
527 T B 0.0000
528 L B 0.0000
529 F B -0.6056
530 L B 0.0000
531 Q B -1.8515
532 M B 0.0000
533 D B -2.7793
534 S B -1.9541
535 L B 0.0000
536 R B -2.7239
537 P B -2.0216
538 E B -2.4646
539 D B 0.0000
540 T B -0.9455
541 G B 0.0000
542 V B 0.1208
543 Y B 0.0000
544 F B 0.0000
545 C B 0.0000
546 T B 0.0000
547 I B 0.0000
548 A B 0.0000
549 A B 1.1098
550 L B 1.8166
551 L B 1.1019
552 S B 0.4220
553 P B 0.0283
554 Y B 0.0000
555 S B 0.4580
556 Y B 1.5256
557 S B 1.3720
558 W B 1.5406
559 G B 0.9680
560 Q B 0.0000
561 G B 0.0000
562 T B 0.0000
563 P B 0.0190
564 V B 0.0976
565 T B -0.0828
566 V B 0.0000
567 S B -0.3651
568 S B -0.2621
569 A B 0.0000
570 S B -0.1884
571 T B 0.0000
572 K B -0.5657
573 G B 0.0000
574 P B -0.4500
575 S B 0.0582
576 V B 1.1805
577 F B 2.1643
578 P B 0.9685
579 L B 0.7476
580 A B -0.5543
581 P B 0.0000
582 S B -0.3738
583 S B -1.1701
584 K B 0.0000
585 S B -1.4713
586 T B 0.0000
587 S B -1.3231
588 G B -0.9597
589 G B -0.5649
590 T B -0.3767
591 A B -0.2513
592 A B 0.0000
593 L B 0.0000
594 G B 0.0000
595 C B 0.0000
596 L B 0.0000
597 V B 0.0000
598 K B -0.4455
599 D B -0.2428
600 Y B 0.0000
601 F B 0.0000
602 P B 0.0000
603 E B -0.8506
604 P B -0.8730
605 V B -0.7474
606 T B -0.6536
607 V B -0.3466
608 S B -0.4121
609 W B 0.0000
610 N B -0.8134
611 S B -0.6948
612 G B -0.6079
613 A B -0.2865
614 L B -0.0120
615 T B -0.1922
616 S B -0.1971
617 G B -0.2798
618 V B 0.1023
619 H B -0.2065
620 T B -0.0458
621 F B 0.0000
622 P B -0.4955
623 A B 0.0952
624 V B 0.5525
625 L B 1.4468
626 Q B 0.3703
627 S B 0.0152
628 S B -0.1124
629 G B 0.4305
630 L B 0.5583
631 Y B 0.0000
632 S B 0.0000
633 L B 0.0000
634 S B 0.0000
635 S B 0.0000
636 V B 0.0000
637 V B 0.0000
638 T B -0.2350
639 V B 0.0000
640 P B -0.3811
641 S B -0.5612
642 S B -0.7130
643 S B -0.7654
644 L B -1.2502
645 G B -1.6842
646 T B -0.9682
647 Q B -1.4695
648 T B -1.3325
649 Y B 0.0000
650 I B -1.5528
651 C B 0.0000
652 N B -1.4967
653 V B 0.0000
654 N B -1.8926
655 H B 0.0000
656 K B -2.7644
657 P B -1.5011
658 S B -1.3151
659 N B -2.4607
660 T B -1.7969
661 K B -2.6102
662 V B -1.2911
663 D B -2.5380
664 K B -2.7069
665 K B -2.9542
666 V B 0.0000
667 E B -2.9287
668 P B -2.2373
669 K B -2.2015
670 S B -1.5279
671 C B -0.9318
672 D B -1.9218
673 K B -2.7473
674 T B -1.5576
675 H B -1.5942
676 T B -0.5697
677 C B 0.3804
678 P B 0.0716
679 P B 0.1642
680 C B 0.3158
681 P B -0.4770
682 A B -0.5498
683 P B -0.6924
684 E B -0.8672
685 L B 1.3175
686 L B 1.2756
687 G B 0.3868
688 G B -0.1229
689 P B 0.0000
690 S B -0.0056
691 V B 0.0000
692 F B 1.1577
693 L B 0.8476
694 F B 1.0729
695 P B -0.2560
696 P B 0.0000
697 K B -2.2187
698 P B -1.3498
699 K B -1.1334
700 D B -1.2510
701 T B 0.0000
702 L B -0.2713
703 M B 0.5775
704 I B 1.5364
705 S B 0.1208
706 R B -1.2121
707 T B -0.6681
708 P B 0.0000
709 E B -1.0451
710 V B 0.0000
711 T B 0.2191
712 C B 0.0000
713 V B 0.0000
714 V B 0.0000
715 V B -0.8511
716 D B -2.1169
717 V B 0.0000
718 S B -1.1761
719 H B -1.3350
720 E B -1.0302
721 D B 0.0000
722 P B -1.7926
723 E B -2.4085
724 V B -1.6794
725 K B -2.0726
726 F B -1.2629
727 N B -1.3713
728 W B 0.0000
729 Y B -0.8512
730 V B -0.8730
731 D B -1.8559
732 G B -0.8655
733 V B 0.4264
734 E B -1.3819
735 V B -0.8406
736 H B -2.0272
737 N B -2.2426
738 A B -1.7526
739 K B -2.4894
740 T B -1.9194
741 K B -2.5613
742 P B -2.4912
743 R B -3.5778
744 E B -3.8249
745 E B -3.6144
746 Q B -2.2480
747 Y B -0.3016
748 N B -1.3638
749 S B -1.2813
750 T B -2.0582
751 Y B -2.7208
752 R B -2.6964
753 V B 0.0000
754 V B 0.0000
755 S B 0.0000
756 V B 0.0000
757 L B 0.0000
758 T B -0.6457
759 V B 0.0000
760 L B 0.3352
761 H B -0.2960
762 Q B -1.4428
763 D B -1.3676
764 W B 0.0000
765 L B -0.9702
766 N B -2.1221
767 G B -2.0654
768 K B -2.1036
769 E B -2.0935
770 Y B 0.0000
771 K B -1.6777
772 C B 0.0000
773 K B -1.6880
774 V B 0.0000
775 S B -1.2222
776 N B 0.0000
777 K B -1.4927
778 A B 0.0000
779 L B 0.0903
780 P B -0.2693
781 A B -0.4881
782 P B -0.7619
783 I B -0.8129
784 E B -2.1179
785 K B -1.2451
786 T B -0.9468
787 I B -0.1652
788 S B -0.9919
789 K B -1.2614
790 A B -1.1951
791 K B -2.3734
792 G B -2.1064
793 Q B -2.3460
794 P B -2.1493
795 R B -2.6436
796 E B -2.5276
797 P B 0.0000
798 Q B -1.1425
799 V B 0.0000
800 Y B 0.0000
801 T B -0.7286
802 L B 0.0000
803 P B -0.2353
804 P B 0.0000
805 S B -1.2943
806 R B -2.2880
807 D B -2.5710
808 E B 0.0000
809 L B -1.5806
810 T B -1.4876
811 K B -2.2455
812 N B -2.6836
813 Q B -2.6499
814 V B 0.0000
815 S B 0.0000
816 L B 0.0000
817 T B 0.0000
818 C B 0.0000
819 L B 0.0000
820 V B 0.0000
821 K B -0.5405
822 G B -1.1481
823 F B 0.0000
824 Y B -1.3075
825 P B 0.0000
826 S B -0.2835
827 D B -1.0044
828 I B -0.5060
829 A B 0.0000
830 V B -0.3534
831 E B -1.0482
832 W B 0.0000
833 E B -1.7862
834 S B 0.0000
835 N B -1.9341
836 G B -1.8966
837 Q B -2.3368
838 P B -1.9772
839 E B -1.9549
840 N B -2.1770
841 N B -1.7005
842 Y B -1.0075
843 K B -0.6042
844 T B -0.1393
845 T B 0.0000
846 P B -0.1559
847 P B 0.0407
848 V B 0.3095
849 L B 0.3836
850 D B -0.7647
851 S B -1.3135
852 D B -1.9765
853 G B -1.0223
854 S B 0.0000
855 F B -0.0927
856 F B 0.0000
857 L B 0.0000
858 Y B 0.0000
859 S B 0.0000
860 K B 0.0000
861 L B 0.0000
862 T B -1.1051
863 V B 0.0000
864 D B -2.9633
865 K B -2.9238
866 S B -2.4895
867 R B -2.3111
868 W B 0.0000
869 Q B -2.3157
870 Q B -2.1595
871 G B -1.1948
872 N B -0.8958
873 V B 0.2315
874 F B 0.0000
875 S B -0.8795
876 C B 0.0000
877 S B 0.0000
878 V B 0.0000
879 M B 0.0000
880 H B 0.0000
881 E B -1.1137
882 A B -1.6608
883 L B 0.0000
884 H B -1.8221
885 N B -1.7403
886 H B -1.1949
887 Y B -0.2809
888 T B -0.7924
889 Q B -1.4240
890 K B -1.2508
891 S B -0.5713
892 L B 0.0000
893 S B -0.1020
894 L B -0.2693
895 S B -0.3054
896 P B -0.7634
897 G B -1.3103
898 K B -2.2962
899 D C -1.9809
900 I C -1.2748
901 Q C -1.7597
902 L C 0.0000
903 T C -0.9043
904 Q C 0.0000
905 S C -0.5672
906 P C -0.4386
907 S C -0.6873
908 S C -0.4785
909 L C -0.2590
910 S C -0.5976
911 A C -0.8889
912 S C -0.7257
913 V C 0.0837
914 G C -0.9368
915 D C -1.9188
916 R C -2.4579
917 V C 0.0000
918 T C -0.6473
919 I C 0.0000
920 T C -0.4741
921 C C 0.0000
922 S C -0.9748
923 V C 0.0000
924 S C -1.0692
925 S C -0.9101
926 S C -0.7577
927 I C 0.0000
928 S C -0.7259
929 S C -0.7765
930 N C -0.9665
931 N C -0.4614
932 L C 0.0000
933 H C 0.0000
934 W C 0.0000
935 Y C 0.0000
936 Q C -0.5321
937 Q C -0.8202
938 K C -1.1918
939 P C -1.1759
940 G C -0.8524
941 K C -1.4395
942 A C 0.0000
943 P C 0.0000
944 K C -0.5597
945 P C -0.0916
946 W C 0.0000
947 I C 0.0000
948 Y C 0.3528
949 G C -0.2534
950 T C 0.0000
951 S C -0.4749
952 N C -0.3126
953 L C 0.1331
954 A C -0.0292
955 S C -0.3432
956 G C -0.4764
957 V C -0.2422
958 P C -0.3126
959 S C -0.3675
960 R C -0.7363
961 F C 0.0000
962 S C -0.2640
963 G C 0.0000
964 S C -0.7136
965 G C -1.0144
966 S C -1.1095
967 G C -0.9978
968 T C -1.0410
969 D C -1.6083
970 Y C 0.0000
971 T C -0.5618
972 F C 0.0000
973 T C -0.5877
974 I C 0.0000
975 S C -1.3456
976 S C -1.3388
977 L C 0.0000
978 Q C -1.2892
979 P C -0.9799
980 E C -1.9042
981 D C 0.0000
982 I C -0.3268
983 A C 0.0000
984 T C -0.4736
985 Y C 0.0000
986 Y C 0.0000
987 C C 0.0000
988 Q C 0.0000
989 Q C 0.0000
990 W C 0.3390
991 S C 0.1711
992 S C 0.2345
993 Y C 0.6747
994 P C 0.0953
995 Y C 0.2050
996 M C 0.0000
997 Y C -0.1017
998 T C -0.7408
999 F C 0.0000
1000 G C 0.0000
1001 Q C -1.8198
1002 G C 0.0000
1003 T C 0.0000
1004 K C -0.6466
1005 V C 0.0000
1006 E C 0.0000
1007 I C -0.6203
1008 K C -1.2801
1009 R C -1.8116
1010 T C -0.1742
1011 V C 0.7970
1012 A C 0.3531
1013 A C 0.0286
1014 P C 0.0000
1015 S C -0.1546
1016 V C 0.0000
1017 F C -0.0352
1018 I C -0.0022
1019 F C 0.0000
1020 P C -0.7637
1021 P C -0.9631
1022 S C -1.6104
1023 D C -2.8939
1024 E C -2.7630
1025 Q C 0.0000
1026 L C -1.9197
1027 K C -2.6024
1028 S C -1.3841
1029 G C -0.9750
1030 T C -0.6592
1031 A C 0.0000
1032 S C 0.0000
1033 V C 0.0000
1034 V C 0.0000
1035 C C 0.0000
1036 L C 0.0000
1037 L C 0.0000
1038 N C -0.3058
1039 N C -1.0021
1040 F C 0.0000
1041 Y C 0.0000
1042 P C -1.7134
1043 R C -3.0814
1044 E C -3.2931
1045 A C -2.3689
1046 K C -2.4592
1047 V C -1.1110
1048 Q C -0.7340
1049 W C 0.0000
1050 K C -0.5985
1051 V C 0.0000
1052 D C -2.1177
1053 N C -1.6031
1054 A C -0.3458
1055 L C 0.6502
1056 Q C -0.2163
1057 S C -0.4873
1058 G C -0.8898
1059 N C -0.7576
1060 S C -1.1820
1061 Q C -1.6587
1062 E C -2.0338
1063 S C -0.8709
1064 V C -0.7538
1065 T C -1.1097
1066 E C -2.1569
1067 Q C -1.9460
1068 D C -2.1164
1069 S C -1.9696
1070 K C -2.7863
1071 D C -3.0244
1072 S C 0.0000
1073 T C 0.0000
1074 Y C 0.0000
1075 S C 0.0000
1076 L C 0.0000
1077 S C 0.0000
1078 S C 0.0000
1079 T C -0.7289
1080 L C 0.0000
1081 T C -0.3136
1082 L C -0.3834
1083 S C -0.9414
1084 K C -1.7595
1085 A C -1.6477
1086 D C -2.1059
1087 Y C 0.0000
1088 E C -3.7313
1089 K C -3.6926
1090 H C -3.3563
1091 K C -3.6089
1092 V C -1.5529
1093 Y C 0.0000
1094 A C -0.5904
1095 C C 0.0000
1096 E C -0.6942
1097 V C 0.0000
1098 T C -1.1770
1099 H C 0.0000
1100 Q C -1.7122
1101 G C -0.3637
1102 L C -0.2458
1103 S C -0.4922
1104 S C -0.4365
1105 P C -0.5931
1106 V C 0.0915
1107 T C -0.3208
1108 K C -0.6722
1109 S C -0.3043
1110 F C -1.0166
1111 N C -2.1514
1112 R C -3.5480
1113 G C -2.9322
1114 E C -2.5561
1115 C C -1.3163
1116 D D -2.0497
1117 I D -1.3828
1118 Q D -1.7708
1119 L D 0.0000
1120 T D -0.9261
1121 Q D 0.0000
1122 S D -0.6499
1123 P D -0.5612
1124 S D -0.8114
1125 S D -0.6378
1126 L D -0.3125
1127 S D -0.5333
1128 A D 0.0000
1129 S D -0.6167
1130 V D -0.2682
1131 G D -1.0103
1132 D D -1.8924
1133 R D -2.3667
1134 V D 0.0000
1135 T D -0.6573
1136 I D 0.0000
1137 T D -0.6126
1138 C D 0.0000
1139 S D -1.1478
1140 V D 0.0000
1141 S D -1.1781
1142 S D -1.0492
1143 S D -0.8771
1144 I D 0.0000
1145 S D -0.6530
1146 S D -0.2910
1147 N D -0.7448
1148 N D 0.0000
1149 L D 0.0000
1150 H D 0.0000
1151 W D 0.0000
1152 Y D 0.0000
1153 Q D 0.0000
1154 Q D -1.3851
1155 K D -2.1361
1156 P D -1.7488
1157 G D -1.7186
1158 K D -2.5297
1159 A D -1.4130
1160 P D 0.0000
1161 K D -1.0572
1162 P D -0.1550
1163 W D 0.0000
1164 I D 0.0000
1165 Y D 0.3380
1166 G D -0.1601
1167 T D 0.0000
1168 S D -0.6711
1169 N D -0.7645
1170 L D 0.2500
1171 A D 0.0000
1172 S D -0.3667
1173 G D -0.4625
1174 V D 0.0000
1175 P D -0.3313
1176 S D -0.3679
1177 R D -0.7393
1178 F D 0.0000
1179 S D -0.4669
1180 G D -0.3610
1181 S D -0.8970
1182 G D -1.2094
1183 S D -1.2573
1184 G D -1.1876
1185 T D -1.3854
1186 D D -2.1594
1187 Y D 0.0000
1188 T D -0.7092
1189 F D 0.0000
1190 T D -0.6086
1191 I D 0.0000
1192 S D -1.2834
1193 S D -1.2279
1194 L D 0.0000
1195 Q D -0.9493
1196 P D -0.9549
1197 E D -1.9090
1198 D D 0.0000
1199 I D -0.2655
1200 A D 0.0000
1201 T D -0.7477
1202 Y D 0.0000
1203 Y D 0.0000
1204 C D 0.0000
1205 Q D 0.0000
1206 Q D -0.1528
1207 W D 0.0000
1208 S D 0.0000
1209 S D 0.9049
1210 Y D 0.9385
1211 P D 0.1071
1212 Y D 0.0000
1213 M D 0.0000
1214 Y D 0.0000
1215 T D -0.6627
1216 F D -0.4260
1217 G D 0.0000
1218 Q D -1.8504
1219 G D -1.0098
1220 T D 0.0000
1221 K D -1.0169
1222 V D 0.0000
1223 E D 0.0000
1224 I D -0.2515
1225 K D -0.6837
1226 R D 0.0000
1227 T D -0.0454
1228 V D 0.3965
1229 A D 0.0000
1230 A D 0.1500
1231 P D 0.0000
1232 S D -0.2635
1233 V D 0.0000
1234 F D -0.0569
1235 I D -0.0460
1236 F D 0.0000
1237 P D -0.8496
1238 P D 0.0000
1239 S D -1.7345
1240 D D -3.1830
1241 E D -3.2692
1242 Q D 0.0000
1243 L D -2.5095
1244 K D -2.9788
1245 S D -1.9626
1246 G D -1.4198
1247 T D -1.0717
1248 A D 0.0000
1249 S D 0.0000
1250 V D 0.0000
1251 V D 0.0000
1252 C D 0.0000
1253 L D 0.0000
1254 L D 0.0000
1255 N D 0.0000
1256 N D -0.9262
1257 F D 0.0000
1258 Y D 0.0000
1259 P D -1.6138
1260 R D -2.8465
1261 E D -3.0747
1262 A D -2.1908
1263 K D -2.1101
1264 V D -0.9855
1265 Q D -0.5438
1266 W D 0.0000
1267 K D -0.7087
1268 V D 0.0000
1269 D D -1.9905
1270 N D -1.5386
1271 A D -0.2607
1272 L D 0.7873
1273 Q D -0.2806
1274 S D -0.5177
1275 G D -0.8909
1276 N D -0.7907
1277 S D -1.0232
1278 Q D -1.1377
1279 E D -1.9708
1280 S D -0.9588
1281 V D -0.9816
1282 T D -1.1706
1283 E D -2.2444
1284 Q D -1.8706
1285 D D -1.9516
1286 S D -1.8958
1287 K D -2.2473
1288 D D -1.6076
1289 S D 0.0000
1290 T D 0.0000
1291 Y D 0.0000
1292 S D 0.0000
1293 L D 0.0000
1294 S D 0.0000
1295 S D 0.0000
1296 T D -0.5830
1297 L D 0.0000
1298 T D -0.2581
1299 L D -0.3419
1300 S D -1.3372
1301 K D -2.3882
1302 A D -1.7573
1303 D D -2.3884
1304 Y D 0.0000
1305 E D -3.7688
1306 K D -3.6860
1307 H D -3.4083
1308 K D -3.3954
1309 V D -2.1617
1310 Y D 0.0000
1311 A D -0.8875
1312 C D 0.0000
1313 E D -0.8929
1314 V D 0.0000
1315 T D -1.1066
1316 H D 0.0000
1317 Q D -1.7229
1318 G D -0.4636
1319 L D -0.0542
1320 S D -0.4834
1321 S D -0.6701
1322 P D -0.5321
1323 V D -0.2065
1324 T D -0.6725
1325 K D -0.9949
1326 S D -0.9737
1327 F D -1.2039
1328 N D -2.3445
1329 R D -2.7973
1330 G D -2.3772
1331 E D -2.2194
1332 C D -0.9004

 

Laboratory of Theory of Biopolymers 2015