Project name: ZEDIII LN [mutate: TE309A, LE307Q, VE391A, EE393A, KE394A]

Status: done

submitted: 2018-07-02 23:48:40, status changed: 2018-07-02 23:53:38
Settings
Chain sequence(s) E: MRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TE309A, LE307Q, VE391A, EE393A, KE394A
Energy difference between WT (input) and mutated protein (by FoldX) 3.6395 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.2015
Maximal score value
1.428
Average score
-0.4686
Total score value
-50.605

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
298 M E 0.8518
299 R E -0.4626
300 L E 1.0959
301 K E -0.2249
302 G E 0.0000
303 V E 1.4280
304 S E 0.4341
305 Y E 0.0888
306 S E -0.4644
307 Q E -1.0803 mutated: LE307Q
308 C E 0.0000
309 A E -0.6973 mutated: TE309A
310 A E -0.4406
311 A E -0.2508
312 F E 0.0000
313 T E -0.5183
314 F E 0.0374
315 T E -0.5627
316 K E -0.6531
317 I E 1.0062
318 P E 0.0000
319 A E -0.4973
320 E E -1.5447
321 T E -0.5952
322 L E 0.6094
323 H E -0.6391
324 G E -0.6601
325 T E -0.9111
326 V E 0.0000
327 T E -0.3211
328 V E 0.0000
329 E E -0.4694
330 V E 0.0000
331 Q E -1.4994
332 Y E 0.0000
333 A E -1.4803
334 G E 0.0000
335 T E -1.9052
336 D E -2.1731
337 G E 0.0000
338 P E -1.2930
339 C E 0.0000
340 K E -0.6840
341 V E 0.0000
342 P E -0.5151
343 A E -0.3751
344 Q E -0.4671
345 M E 0.0000
346 A E 0.0000
347 V E 0.9126
348 D E -0.3213
349 M E 0.0023
350 Q E -1.0343
351 T E -0.5102
352 L E 0.0964
353 T E -0.0152
354 P E -0.3852
355 V E -0.0494
356 G E -0.7769
357 R E -1.7654
358 L E -0.2217
359 I E 0.5812
360 T E 0.3199
361 A E -0.0117
362 N E -0.2562
363 P E 0.0000
364 V E 0.0000
365 I E 0.0000
366 T E -1.1992
367 E E -2.4092
368 S E -1.9751
369 T E -2.0300
370 E E -3.2015
371 N E -2.8420
372 S E -2.4114
373 K E -2.3308
374 M E -0.6940
375 M E -0.1056
376 L E 0.0000
377 E E -0.5209
378 L E 0.0000
379 D E -0.9260
380 P E 0.0000
381 P E -0.1005
382 F E 0.4088
383 G E -0.6354
384 D E -1.6240
385 S E 0.0000
386 Y E 0.1758
387 I E 0.0000
388 V E 0.0000
389 I E 0.0000
390 G E -0.5457
391 A E -0.5326 mutated: VE391A
392 G E -0.5614
393 A E -0.2911 mutated: EE393A
394 A E -0.3122 mutated: KE394A
395 K E -0.5980
396 I E 0.0443
397 T E -0.0360
398 H E -0.0045
399 H E -0.8225
400 W E -1.0051
401 H E -1.6658
402 R E -1.1577
403 S E -0.7380
404 G E -0.4890
405 S E -0.1999

 

Laboratory of Theory of Biopolymers 2015