Project name: apoD

Status: done

submitted: 2017-03-15 01:46:35, status changed: 2017-03-15 01:54:27
Settings
Chain sequence(s) A: FHLGKCPNPPVQENFDVNKYPGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYHILATDYENYALVYSCTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKL
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.0759
Maximal score value
2.6577
Average score
-0.6771
Total score value
-112.3982

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 F A 2.2903
4 H A 1.0412
5 L A 1.4056
6 G A -0.1560
7 K A -1.7856
8 C A -1.0569
9 P A -1.4023
10 N A -1.7230
11 P A 0.0000
12 P A -0.7900
13 V A -0.9223
14 Q A -1.6694
15 E A -2.7551
16 N A -2.5886
17 F A 0.0000
18 D A -2.9286
19 V A -1.7612
20 N A -2.3690
21 K A -2.9695
22 Y A 0.0000
23 P A -1.2867
24 G A -1.2177
25 R A -1.8653
26 W A 0.0000
27 Y A 0.0000
28 E A 0.0000
29 I A 0.0000
30 E A 0.0000
31 K A 0.1814
32 I A 0.0000
33 P A -0.0217
34 T A 0.0463
35 T A 0.0805
36 F A 0.8118
37 E A -1.4579
38 N A -1.6730
39 G A -1.4133
40 R A -0.7008
41 C A 0.0000
42 I A -0.4550
43 Q A -0.7519
44 A A 0.0000
45 N A -1.5647
46 Y A 0.0000
47 S A -1.0622
48 L A -1.2412
49 M A -1.5291
50 E A -2.4708
51 N A -2.3925
52 G A -1.8204
53 K A -2.1209
54 I A 0.0000
55 K A -2.4725
56 V A 0.0000
57 L A -1.2929
58 N A -1.1701
59 Q A -1.1840
60 E A -0.9617
61 L A -1.1542
62 R A -1.8269
63 A A -1.5310
64 D A -1.9920
65 G A -1.2894
66 T A -0.5824
67 V A -0.1550
68 N A -1.0862
69 Q A -1.4101
70 I A -0.5982
71 E A -2.1327
72 G A 0.0000
73 E A -2.6798
74 A A 0.0000
75 T A -1.3456
76 P A -0.3040
77 V A 0.2692
78 N A 0.0761
79 L A 1.1191
80 T A 0.2887
81 E A -0.6164
82 P A -0.7628
83 A A 0.0000
84 K A -0.4257
85 L A 0.0000
86 E A -1.0185
87 V A -1.0941
88 K A -1.0923
89 F A -0.1800
90 S A 0.9595
91 W A 2.1534
92 F A 2.6577
93 M A 1.6120
94 P A 0.4237
95 S A -0.2343
96 A A -0.3489
97 P A -0.3208
98 Y A -0.1991
99 H A -0.4068
100 I A 0.0000
101 L A 0.0000
102 A A 0.0000
103 T A 0.0000
104 D A -1.8784
105 Y A -2.2797
106 E A -3.0759
107 N A -2.5258
108 Y A -1.2032
109 A A 0.0000
110 L A 0.0000
111 V A 0.0000
112 Y A 0.0000
113 S A 0.0000
114 C A 0.0000
115 T A 0.1720
116 S A 0.0669
117 I A 0.9575
118 S A -0.5071
119 Q A -1.3569
120 S A -0.5375
121 F A 0.8415
122 H A 0.0000
123 V A 1.2950
124 D A 0.3266
125 F A 0.2279
126 A A 0.0000
127 W A 0.2056
128 I A 0.0000
129 L A 0.0000
130 A A 0.0000
131 R A -2.0189
132 N A -1.6983
133 V A 0.1863
134 A A 0.0393
135 L A -0.5046
136 P A -1.1058
137 P A -1.6120
138 E A -2.6485
139 T A -1.8226
140 V A -1.6359
141 D A -2.9320
142 S A -1.9559
143 L A 0.0000
144 K A -1.8694
145 N A -1.9174
146 I A -0.8103
147 L A 0.0000
148 T A -1.5023
149 S A -1.1476
150 N A -1.5811
151 N A -1.9304
152 I A 0.0000
153 D A -2.0610
154 V A -1.7249
155 K A -2.5262
156 K A -2.2773
157 M A -0.8089
158 T A 0.2085
159 V A 1.5344
160 T A 0.0000
161 D A 0.0965
162 Q A 0.2229
163 V A 0.8238
164 N A -0.7972
165 C A -0.3638
166 P A -0.5147
167 K A -0.8678
168 L A 0.7709

 

Laboratory of Theory of Biopolymers 2015