Project name: 26f71f19794a3b5

Status: done

submitted: 2017-11-14 10:15:57, status changed: 2017-11-14 11:04:15
Settings
Chain sequence(s) A: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTMKIDAIVGRNSAKDIKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTMKIDAIVGRNSAKDIKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.878
Maximal score value
2.3031
Average score
-0.7868
Total score value
-1043.2465

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.2048
2 I A 0.6199
3 V A 0.0000
4 L A -0.2264
5 T A 0.0000
6 Q A -1.7266
7 S A -0.8761
8 P A 0.0000
9 G A -0.7570
10 T A -0.3827
11 L A -0.1574
12 S A -0.5842
13 L A 0.0000
14 S A -2.1610
15 P A -2.3833
16 G A -2.6883
17 E A -3.3055
18 R A -3.3274
19 A A 0.0000
20 T A -0.7634
21 L A 0.0000
22 S A -1.1215
23 C A 0.0000
24 R A -2.2700
25 A A 0.0000
26 S A -1.0510
27 Q A -1.9009
28 S A -1.6009
29 V A 0.0000
30 G A -0.6762
31 S A -0.4380
32 S A 0.3017
33 Y A 1.0781
34 L A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A -1.0352
39 Q A -1.2784
40 K A -1.5258
41 P A -1.0957
42 G A -1.3692
43 Q A -2.1346
44 A A -1.6011
45 P A 0.0000
46 R A -2.1469
47 L A 0.0000
48 L A 0.0000
49 I A 0.0000
50 Y A 1.1031
51 G A 1.1402
52 A A 0.9156
53 F A 1.6759
54 S A 0.4183
55 R A -0.8039
56 A A -0.3824
57 T A -0.5087
58 G A -0.7634
59 I A -0.7970
60 P A -1.4028
61 D A -2.1344
62 R A -1.7986
63 F A 0.0000
64 S A -0.2880
65 G A 0.4570
66 S A 0.0674
67 G A -0.5637
68 S A -0.8740
69 G A -1.2144
70 T A -1.8474
71 D A -2.2504
72 F A 0.0000
73 T A -0.6283
74 L A 0.0000
75 T A -0.7420
76 I A 0.0000
77 S A -2.5694
78 R A -3.4744
79 L A 0.0000
80 E A -2.0258
81 P A -1.8949
82 E A -2.2162
83 D A 0.0000
84 F A 0.0000
85 A A 0.0000
86 V A -0.2706
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 Q A 0.0000
91 Q A 0.0000
92 Y A 0.1953
93 G A -0.3970
94 S A -0.6137
95 S A -0.6822
96 P A -0.7498
97 W A -0.2085
98 T A -0.1224
99 F A 0.0000
100 G A 0.0000
101 Q A -1.4378
102 G A -1.1783
103 T A 0.0000
104 K A -0.5652
105 V A 0.0000
106 E A -0.8952
107 I A -1.4058
108 K A -1.9518
109 R A -2.1497
110 T A -0.3961
111 V A 0.8683
112 A A 0.3077
113 A A 0.1296
114 P A 0.0105
115 S A -0.3096
116 V A 0.0000
117 F A 0.0435
118 I A 0.0000
119 F A 0.0000
120 P A -0.4419
121 P A 0.0000
122 S A -1.8928
123 D A -3.4867
124 E A -3.2889
125 Q A 0.0000
126 L A 0.0000
127 K A -3.1086
128 S A -1.8722
129 G A -1.2480
130 T A -0.9669
131 A A 0.0000
132 S A 0.0000
133 V A 0.0000
134 V A 0.0000
135 C A 0.0000
136 L A 0.0000
137 L A 0.0000
138 N A 0.0000
139 N A -0.8178
140 F A 0.0000
141 Y A 0.0000
142 P A -1.8291
143 R A -3.0973
144 E A -3.3151
145 A A -2.5296
146 K A -2.5277
147 V A -1.3480
148 Q A -1.1072
149 W A 0.0000
150 K A -0.6782
151 V A -0.8665
152 D A -1.5222
153 N A -1.2864
154 A A -0.3511
155 L A 0.3662
156 Q A -1.0299
157 S A -0.8402
158 G A -1.2657
159 N A -1.8783
160 S A -1.5557
161 Q A -1.2551
162 E A -1.8531
163 S A -0.6644
164 V A -0.5063
165 T A -0.6731
166 E A -1.3368
167 Q A 0.0000
168 D A -2.2214
169 S A -2.1628
170 K A -2.4481
171 D A -2.1847
172 S A -2.1982
173 T A 0.0000
174 Y A 0.0000
175 S A 0.0000
176 L A 0.0000
177 S A 0.0000
178 S A 0.0000
179 T A 0.0000
180 L A 0.0000
181 T A -0.5193
182 L A -0.7254
183 S A -1.2431
184 K A -1.9708
185 A A -2.0073
186 D A -2.8028
187 Y A 0.0000
188 E A -2.8081
189 K A -3.3373
190 H A -2.6463
191 K A -2.5663
192 V A -1.2450
193 Y A 0.0000
194 A A -0.9436
195 C A 0.0000
196 E A -1.1588
197 V A 0.0000
198 T A -1.1984
199 H A 0.0000
200 Q A -1.7656
201 G A -0.3775
202 L A -0.0410
203 S A -0.3950
204 S A -0.3492
205 P A -0.5592
206 V A -0.0804
207 T A -0.6076
208 K A -0.9440
209 S A -0.7462
210 F A 0.0000
211 N A -1.6214
212 R A -2.1406
213 G A -1.8445
214 E A -2.7484
215 C A -2.1882
216 Q B -1.4457
217 V B -1.0307
218 Q B -1.4420
219 L B 0.0000
220 V B -0.2540
221 E B 0.0000
222 S B -0.6232
223 G B -0.7983
224 G B -0.4546
225 G B 0.2203
226 V B 0.5590
227 V B -0.5880
228 Q B -1.9408
229 P B -2.1578
230 G B -2.2813
231 R B -2.7479
232 S B -2.1070
233 L B -1.4744
234 R B -2.1545
235 L B 0.0000
236 S B -0.5886
237 C B 0.0000
238 A B -0.3922
239 A B -0.6942
240 S B -0.9835
241 G B -0.8596
242 F B -0.1145
243 T B -0.0745
244 F B 0.0000
245 S B -0.5542
246 S B -0.1847
247 Y B 0.2150
248 T B 0.1696
249 M B 0.0000
250 H B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B -0.5339
254 Q B -0.9126
255 A B -1.2122
256 P B -1.0594
257 G B -1.4813
258 K B -2.4588
259 G B -1.7475
260 L B -1.0109
261 E B -1.3140
262 W B 0.0000
263 V B 0.0000
264 T B 0.0000
265 M B -0.4686
266 K B 0.0000
267 I B 0.6274
268 D B 0.2848
269 A B 0.9398
270 I B 1.7203
271 V B 1.8845
272 G B 0.0911
273 R B -1.4156
274 N B -1.6073
275 S B -1.9656
276 A B -2.1270
277 K B -3.4171
278 D B -3.8780
279 I B -3.1373
280 K B -3.6656
281 G B -2.6766
282 R B -3.4905
283 F B 0.0000
284 T B -1.5448
285 I B 0.0000
286 S B -0.4491
287 R B 0.0000
288 D B -1.2639
289 N B -1.3410
290 S B -1.5493
291 K B -2.3866
292 N B -1.7912
293 T B 0.0000
294 L B 0.0000
295 Y B -0.4238
296 L B 0.0000
297 Q B -1.7368
298 M B 0.0000
299 N B -2.2855
300 S B -2.0968
301 L B 0.0000
302 R B -3.4868
303 A B -2.1311
304 E B -2.7767
305 D B -1.9532
306 T B -0.7824
307 A B 0.0000
308 I B 0.2562
309 Y B 0.0000
310 Y B 0.0000
311 C B 0.0000
312 A B 0.0000
313 R B -0.0412
314 T B 0.5060
315 G B 0.0000
316 W B 1.9967
317 L B 2.1046
318 G B 1.0896
319 P B 0.0000
320 F B 0.0000
321 D B -0.4239
322 Y B -0.5633
323 W B 0.0000
324 G B 0.0000
325 Q B -1.3999
326 G B -0.6305
327 T B -0.1030
328 L B 0.4376
329 V B 0.0000
330 T B -0.0213
331 V B 0.0000
332 S B -0.8449
333 S B -0.6323
334 A B -0.4593
335 S B -0.6771
336 T B -0.7153
337 K B -1.3336
338 G B -1.3429
339 P B -0.6619
340 S B -0.5840
341 V B 0.0000
342 F B 0.0000
343 P B -1.5006
344 L B 0.0000
345 A B -0.9749
346 P B -0.8029
347 S B -1.2462
348 S B -1.6651
349 K B -1.9184
350 S B -1.4920
351 T B -0.9536
352 S B -1.0186
353 G B -0.7747
354 G B -0.7060
355 T B -0.5146
356 A B 0.0000
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.3556
364 D B -0.6262
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.4807
369 P B -0.6910
370 V B -0.5876
371 T B -0.5194
372 V B 0.0618
373 S B -0.2957
374 W B 0.0000
375 N B -0.9455
376 S B -0.6691
377 G B -0.3634
378 A B -0.1356
379 L B 0.1469
380 T B -0.0258
381 S B -0.0823
382 G B -0.0453
383 V B 0.4156
384 H B -0.0867
385 T B 0.0905
386 F B 0.0000
387 P B -0.1313
388 A B 0.4296
389 V B 0.7279
390 L B 1.2661
391 Q B -0.0894
392 S B -0.2647
393 S B -0.3380
394 G B 0.0000
395 L B 0.0213
396 Y B 0.0000
397 S B 0.0000
398 L B 0.0785
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0346
404 V B 0.0000
405 P B -0.5147
406 S B -0.5838
407 S B -0.6824
408 S B -0.7795
409 L B -0.9050
410 G B -1.1397
411 T B -0.9196
412 Q B -1.3837
413 T B -1.3931
414 Y B 0.0000
415 I B -1.6412
416 C B 0.0000
417 N B -1.6406
418 V B 0.0000
419 N B -1.9341
420 H B 0.0000
421 K B -2.6786
422 P B -1.5543
423 S B -1.8481
424 N B -2.5060
425 T B -2.1174
426 K B -2.6768
427 V B -1.9165
428 D B -2.8486
429 K B -2.5491
430 R B -3.0606
431 V B 0.0000
432 E B -2.9614
433 P B -2.2083
434 K B -2.8509
435 S B -1.8107
436 C B -1.6735
437 D B -1.8402
438 K B 0.0000
439 T B 0.0000
440 H B -1.4175
441 T B -1.1835
442 C B -1.1124
443 P B -0.6602
444 P B -0.8028
445 C B -0.9113
446 P B -0.9252
447 A B -0.7153
448 P B -0.4183
449 E B -1.1826
450 L B 0.6643
451 L B 1.4245
452 G B 0.2890
453 G B 0.0257
454 P B -0.2461
455 S B 0.0558
456 V B 0.0000
457 F B 1.0682
458 L B 0.0000
459 F B 1.3703
460 P B -0.0322
461 P B 0.0000
462 K B -2.0413
463 P B -1.3518
464 K B -1.1122
465 D B 0.0000
466 T B 0.0000
467 L B 0.0000
468 M B 0.8311
469 I B 1.7322
470 S B 0.1761
471 R B -0.9239
472 T B -0.5016
473 P B 0.0000
474 E B -0.9892
475 V B 0.0000
476 T B 0.6094
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.1589
481 D B -0.6626
482 V B 0.0000
483 S B -1.7287
484 H B -2.1647
485 E B -2.7414
486 D B 0.0000
487 P B -2.3011
488 E B -2.6317
489 V B 0.0000
490 K B -2.4669
491 F B 0.0000
492 N B -1.6539
493 W B 0.0000
494 Y B -0.9264
495 V B -0.4116
496 D B -1.2430
497 G B -0.4432
498 V B 0.8066
499 E B -0.7541
500 V B 0.0159
501 H B -1.3111
502 N B -1.2269
503 A B -1.0694
504 K B -2.0764
505 T B -1.4887
506 K B -2.2913
507 P B -2.1113
508 R B -3.4902
509 E B -3.4966
510 E B -3.4024
511 Q B -2.6566
512 Y B -1.3159
513 N B -1.4405
514 S B -1.0771
515 T B -1.4607
516 Y B -2.2658
517 R B -2.1076
518 V B 0.0000
519 V B -0.9221
520 S B 0.0000
521 V B -0.0626
522 L B 0.0000
523 T B -0.2983
524 V B 0.4314
525 L B 0.9340
526 H B -0.0203
527 Q B -1.2974
528 D B -1.0392
529 W B 0.0000
530 L B -1.1337
531 N B -1.7777
532 G B -1.7139
533 K B -1.5682
534 E B -1.3417
535 Y B 0.0000
536 K B -1.4968
537 C B 0.0000
538 K B -1.7297
539 V B 0.0000
540 S B -1.4497
541 N B -1.8044
542 K B -2.0748
543 A B -1.2220
544 L B -0.5772
545 P B -0.4374
546 A B -0.3557
547 P B -0.5183
548 I B -0.4298
549 E B -1.3742
550 K B -1.0651
551 T B -0.7278
552 I B 0.2528
553 S B -1.0419
554 K B -1.1911
555 A B -1.2168
556 K B -2.2672
557 G B -2.0055
558 Q B -2.0106
559 P B -1.9558
560 R B -2.1707
561 E B -2.4976
562 P B 0.0000
563 Q B -1.6670
564 V B 0.0000
565 Y B 0.0000
566 T B 0.0000
567 L B -0.2518
568 P B -0.4443
569 P B 0.0000
570 S B -1.2878
571 R B -2.4940
572 D B -2.6123
573 E B 0.0000
574 L B -0.8885
575 T B -1.0686
576 K B -1.8425
577 N B -2.3660
578 Q B -2.2615
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B 0.0000
587 G B -0.8635
588 F B 0.0000
589 Y B -1.0810
590 P B 0.0000
591 S B -0.0801
592 D B -1.0331
593 I B 0.0000
594 A B -0.5037
595 V B -0.4700
596 E B -1.3325
597 W B 0.0000
598 E B -1.8969
599 S B 0.0000
600 N B -1.6578
601 G B -1.5989
602 Q B -1.8355
603 P B -1.8290
604 E B -2.0970
605 N B -2.1038
606 N B -1.6973
607 Y B -1.0185
608 K B -0.5255
609 T B -0.3024
610 T B 0.0000
611 P B 0.0431
612 P B 0.2785
613 V B 0.7860
614 L B 0.9453
615 D B 0.0000
616 S B -1.1883
617 D B -1.8775
618 G B -0.7439
619 S B 0.0000
620 F B 0.3537
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.8771
628 V B -1.2628
629 D B -2.3878
630 K B -2.1326
631 S B -1.8853
632 R B -2.1394
633 W B -1.8379
634 Q B -2.1939
635 Q B -2.3099
636 G B -1.4895
637 N B -1.1284
638 V B -0.3751
639 F B 0.0000
640 S B -1.0312
641 C B 0.0000
642 S B -0.6973
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.0556
647 A B -1.5905
648 L B 0.0000
649 H B -1.6462
650 N B -1.5332
651 H B -0.8783
652 Y B 0.0278
653 T B -0.7572
654 Q B -1.0271
655 K B -0.8660
656 S B -0.2172
657 L B 0.0000
658 S B 0.0000
659 L B 0.8506
660 S B -0.0053
661 P B -0.5307
662 G B -0.5933
663 K B -1.6426
664 E C -1.1493
665 I C 0.6846
666 V C 0.0000
667 L C -0.1389
668 T C 0.0000
669 Q C -1.3616
670 S C -0.8332
671 P C -1.0001
672 G C -1.0206
673 T C -0.7433
674 L C -0.3165
675 S C -0.5816
676 L C -1.3400
677 S C -1.8848
678 P C -2.1975
679 G C -2.5368
680 E C -2.9691
681 R C -3.1585
682 A C 0.0000
683 T C -0.6818
684 L C 0.0000
685 S C -1.0516
686 C C 0.0000
687 R C -2.1524
688 A C 0.0000
689 S C -1.0916
690 Q C -1.8982
691 S C -1.5578
692 V C 0.0000
693 G C -0.4687
694 S C -0.4221
695 S C 0.1230
696 Y C 1.0037
697 L C 0.0000
698 A C 0.0000
699 W C 0.0000
700 Y C 0.0000
701 Q C -0.7651
702 Q C -1.1113
703 K C -1.4689
704 P C -1.3855
705 G C -1.5664
706 Q C -2.0439
707 A C -1.4255
708 P C 0.0000
709 R C -1.3522
710 L C 0.0000
711 L C 0.0000
712 I C 0.0000
713 Y C 0.4132
714 G C 0.3556
715 A C 0.2175
716 F C 0.1793
717 S C -0.6234
718 R C -1.9634
719 A C 0.0000
720 T C -0.6710
721 G C -0.9048
722 I C -0.9886
723 P C -1.4816
724 D C -2.1699
725 R C 0.0000
726 F C 0.0000
727 S C -0.7122
728 G C 0.0000
729 S C -0.3448
730 G C -0.8147
731 S C -0.9093
732 G C -1.2230
733 T C -1.8237
734 D C -2.1912
735 F C 0.0000
736 T C -0.7596
737 L C 0.0000
738 T C -0.6864
739 I C 0.0000
740 S C -2.4093
741 R C -3.2303
742 L C 0.0000
743 E C -2.1061
744 P C -1.9617
745 E C -2.2456
746 D C 0.0000
747 F C 0.0000
748 A C 0.0000
749 V C -0.5577
750 Y C 0.0000
751 Y C 0.0000
752 C C 0.0000
753 Q C 0.0000
754 Q C 0.0000
755 Y C 0.1800
756 G C -0.3445
757 S C -0.5461
758 S C -0.6836
759 P C -0.7202
760 W C -0.1466
761 T C -0.0407
762 F C 0.0000
763 G C 0.0000
764 Q C -1.4914
765 G C -1.2618
766 T C 0.0000
767 K C -1.4056
768 V C 0.0000
769 E C -1.0508
770 I C 0.0000
771 K C -1.4924
772 R C -1.2844
773 T C 0.0219
774 V C 1.0726
775 A C 0.4674
776 A C 0.1512
777 P C -0.1487
778 S C -0.2517
779 V C 0.0000
780 F C 0.1087
781 I C 0.0000
782 F C 0.0000
783 P C 0.0000
784 P C 0.0000
785 S C 0.0000
786 D C -3.1200
787 E C -3.2219
788 Q C 0.0000
789 L C -2.3857
790 K C -2.8926
791 S C -1.8108
792 G C -1.3541
793 T C -0.9321
794 A C 0.0000
795 S C 0.0000
796 V C 0.0000
797 V C 0.0000
798 C C 0.0000
799 L C 0.0000
800 L C 0.0000
801 N C 0.0000
802 N C -0.8068
803 F C 0.0000
804 Y C 0.0000
805 P C -1.7030
806 R C -3.2252
807 E C -3.3207
808 A C -2.5441
809 K C -2.7138
810 V C -1.3356
811 Q C -1.0580
812 W C 0.0000
813 K C -0.6265
814 V C -0.7182
815 D C -1.3794
816 N C -1.2247
817 A C -0.3157
818 L C 0.3822
819 Q C -1.0359
820 S C -0.8977
821 G C -1.3023
822 N C -2.0042
823 S C -1.5677
824 Q C -1.2804
825 E C -2.0349
826 S C 0.0000
827 V C -0.8103
828 T C -1.1328
829 E C -2.3343
830 Q C 0.0000
831 D C -2.3668
832 S C -2.3826
833 K C -2.5558
834 D C -2.3249
835 S C -2.2411
836 T C 0.0000
837 Y C 0.0000
838 S C 0.0000
839 L C 0.0000
840 S C 0.0000
841 S C 0.0000
842 T C 0.0000
843 L C 0.0000
844 T C -0.5791
845 L C -0.6710
846 S C -1.3001
847 K C -2.2910
848 A C -2.1410
849 D C -2.4010
850 Y C 0.0000
851 E C -3.7556
852 K C -3.5591
853 H C -3.0382
854 K C -3.2227
855 V C -1.4470
856 Y C 0.0000
857 A C -0.8972
858 C C 0.0000
859 E C -1.1938
860 V C 0.0000
861 T C -1.1913
862 H C 0.0000
863 Q C -1.7485
864 G C -0.3374
865 L C 0.0413
866 S C -0.3523
867 S C -0.3002
868 P C -0.5340
869 V C -0.0128
870 T C -0.5330
871 K C -0.7388
872 S C -0.7443
873 F C 0.0000
874 N C -2.1598
875 R C -2.4490
876 G C -1.8057
877 E C -1.5520
878 C C -0.7675
879 Q D -1.3618
880 V D -0.8768
881 Q D -1.3230
882 L D 0.0000
883 V D -0.2802
884 E D -0.3831
885 S D -0.7349
886 G D -0.8237
887 G D -0.4562
888 G D 0.1679
889 V D 0.4144
890 V D 0.0000
891 Q D -1.9190
892 P D -2.1367
893 G D -2.2744
894 R D -2.7239
895 S D -1.9844
896 L D -1.2667
897 R D -2.0493
898 L D 0.0000
899 S D -0.7543
900 C D 0.0000
901 A D -0.5379
902 A D 0.0000
903 S D -0.9795
904 G D -0.9036
905 F D -0.2489
906 T D -0.1335
907 F D 0.0000
908 S D -0.6428
909 S D -0.3235
910 Y D -0.0042
911 T D 0.0109
912 M D 0.0000
913 H D 0.0000
914 W D 0.0000
915 V D 0.0000
916 R D 0.0000
917 Q D -0.7977
918 A D -1.1388
919 P D -1.0692
920 G D -1.4749
921 K D -2.4279
922 G D -1.6985
923 L D -0.9548
924 E D -1.0477
925 W D 0.0000
926 V D 0.0000
927 T D 0.0000
928 M D -0.7684
929 K D 0.0000
930 I D 0.3984
931 D D 0.2227
932 A D 0.9153
933 I D 1.7976
934 V D 1.8401
935 G D -0.1230
936 R D -1.6265
937 N D -1.9430
938 S D -2.3649
939 A D -2.5891
940 K D -3.4372
941 D D -3.8409
942 I D 0.0000
943 K D -3.7060
944 G D -2.6066
945 R D -3.3583
946 F D 0.0000
947 T D -1.5268
948 I D 0.0000
949 S D -0.4837
950 R D 0.0000
951 D D -1.5186
952 N D -1.3918
953 S D -1.6360
954 K D -2.4661
955 N D -1.8470
956 T D -1.1569
957 L D 0.0000
958 Y D -0.5877
959 L D 0.0000
960 Q D -1.6397
961 M D 0.0000
962 N D -2.2215
963 S D -2.0106
964 L D 0.0000
965 R D -3.4165
966 A D -2.0397
967 E D -2.6795
968 D D 0.0000
969 T D -0.6759
970 A D 0.0000
971 I D 0.3826
972 Y D 0.0000
973 Y D 0.0000
974 C D 0.0000
975 A D 0.0000
976 R D 0.0000
977 T D 0.2849
978 G D 0.2883
979 W D 0.9730
980 L D 0.5610
981 G D 0.0000
982 P D 0.4351
983 F D 0.0000
984 D D 0.0000
985 Y D 0.0477
986 W D 0.0000
987 G D 0.0000
988 Q D -1.4318
989 G D -0.6592
990 T D -0.1417
991 L D 0.3580
992 V D 0.0000
993 T D -0.0533
994 V D 0.0000
995 S D -0.8653
996 S D -0.6528
997 A D -0.6125
998 S D -0.8597
999 T D -1.0883
1000 K D -2.0680
1001 G D -1.8045
1002 P D -0.9621
1003 S D -0.5232
1004 V D 0.0000
1005 F D 0.0000
1006 P D -1.5253
1007 L D 0.0000
1008 A D 0.0000
1009 P D -0.7353
1010 S D 0.0000
1011 S D -1.2186
1012 K D -2.0384
1013 S D -1.2596
1014 T D -0.9783
1015 S D -0.8764
1016 G D -0.7672
1017 G D -0.6931
1018 T D -0.5027
1019 A D -0.3309
1020 A D 0.0000
1021 L D 0.0000
1022 G D 0.0000
1023 C D 0.0000
1024 L D 0.0000
1025 V D 0.0000
1026 K D -0.5906
1027 D D -1.1113
1028 Y D 0.0000
1029 F D 0.0000
1030 P D 0.0000
1031 E D -0.5428
1032 P D -0.6716
1033 V D -0.7618
1034 T D -0.5265
1035 V D 0.0438
1036 S D -0.2735
1037 W D 0.0000
1038 N D -0.7339
1039 S D -0.5915
1040 G D -0.3281
1041 A D -0.0228
1042 L D 0.3596
1043 T D 0.0545
1044 S D -0.0198
1045 G D -0.1001
1046 V D 0.3363
1047 H D -0.1249
1048 T D 0.0270
1049 F D 0.0000
1050 P D -0.2811
1051 A D 0.1901
1052 V D 0.6007
1053 L D 1.1318
1054 Q D -0.4278
1055 S D -0.3674
1056 S D -0.5441
1057 G D -0.2337
1058 L D -0.3179
1059 Y D 0.0000
1060 S D 0.0000
1061 L D 0.0000
1062 S D 0.0000
1063 S D 0.0000
1064 V D 0.0000
1065 V D 0.0000
1066 T D -0.0426
1067 V D 0.0000
1068 P D -0.5507
1069 S D -0.5704
1070 S D -0.6498
1071 S D -0.7659
1072 L D -0.8870
1073 G D -1.1793
1074 T D -0.9134
1075 Q D -1.3814
1076 T D -1.3414
1077 Y D 0.0000
1078 I D -1.3656
1079 C D 0.0000
1080 N D -1.6024
1081 V D 0.0000
1082 N D -1.9546
1083 H D 0.0000
1084 K D -2.6783
1085 P D -1.6629
1086 S D -1.9924
1087 N D -2.5120
1088 T D -2.1314
1089 K D -2.6461
1090 V D -1.8728
1091 D D -2.7650
1092 K D -2.4811
1093 R D -2.9942
1094 V D 0.0000
1095 E D -2.6931
1096 P D -1.6440
1097 K D -1.5308
1098 S D -1.5534
1099 C D -1.1637
1100 D D -2.4991
1101 K D -2.5734
1102 T D -1.8701
1103 H D 0.0000
1104 T D -1.7309
1105 C D 0.0000
1106 P D -1.4549
1107 P D -0.8922
1108 C D 0.0000
1109 P D -0.9140
1110 A D -1.0549
1111 P D -0.9467
1112 E D -1.2040
1113 L D 0.2404
1114 L D 1.2181
1115 G D 0.0223
1116 G D -0.0768
1117 P D -0.1811
1118 S D 0.2064
1119 V D 0.0000
1120 F D 2.3031
1121 L D 1.7708
1122 F D 2.1431
1123 P D 0.4828
1124 P D 0.0000
1125 K D -2.1440
1126 P D -1.6240
1127 K D -1.6887
1128 D D -1.6612
1129 T D 0.0000
1130 L D 0.0000
1131 M D 0.3014
1132 I D 1.2878
1133 S D -0.1123
1134 R D -1.4914
1135 T D -0.8198
1136 P D 0.0000
1137 E D -1.0363
1138 V D 0.0000
1139 T D 1.0035
1140 C D 0.0000
1141 V D 0.9269
1142 V D 0.0000
1143 V D 0.1448
1144 D D -0.3526
1145 V D 0.0000
1146 S D -1.6705
1147 H D -2.2596
1148 E D -2.7125
1149 D D 0.0000
1150 P D -2.0728
1151 E D -2.3680
1152 V D 0.0000
1153 K D -2.4281
1154 F D -1.9198
1155 N D -1.5810
1156 W D 0.0000
1157 Y D -1.1158
1158 V D -0.6942
1159 D D -1.6085
1160 G D -0.6348
1161 V D 0.8678
1162 E D -0.6198
1163 V D 0.2210
1164 H D -1.1805
1165 N D -1.2040
1166 A D -1.2012
1167 K D -2.2456
1168 T D -1.6734
1169 K D -2.5603
1170 P D -2.1435
1171 R D -2.4804
1172 E D -2.4499
1173 E D -2.3691
1174 Q D -1.8058
1175 Y D -0.8560
1176 N D -0.8420
1177 S D -0.7666
1178 T D -0.8418
1179 Y D 0.0000
1180 R D -1.5274
1181 V D 0.0000
1182 V D -0.6792
1183 S D 0.0000
1184 V D -0.1177
1185 L D 0.0000
1186 T D -0.3756
1187 V D 0.4138
1188 L D 1.0456
1189 H D -0.0698
1190 Q D -1.0249
1191 D D -1.0943
1192 W D -0.9361
1193 L D -0.9337
1194 N D -2.0200
1195 G D -2.0467
1196 K D -2.3069
1197 E D -2.4353
1198 Y D 0.0000
1199 K D -1.9237
1200 C D 0.0000
1201 K D -1.8457
1202 V D 0.0000
1203 S D -1.4013
1204 N D -1.7333
1205 K D -2.0418
1206 A D -1.2425
1207 L D -0.5907
1208 P D -0.4936
1209 A D -0.3524
1210 P D -0.5272
1211 I D -0.5165
1212 E D -1.4486
1213 K D -1.2058
1214 T D -1.1291
1215 I D -0.1488
1216 S D -1.7155
1217 K D -1.7139
1218 A D -1.4496
1219 K D -2.3907
1220 G D -2.1594
1221 Q D -2.4076
1222 P D -2.4096
1223 R D -3.1160
1224 E D -3.0606
1225 P D 0.0000
1226 Q D -1.4347
1227 V D 0.0000
1228 Y D 0.0000
1229 T D -0.6990
1230 L D -0.1596
1231 P D -0.5226
1232 P D 0.0000
1233 S D -1.1996
1234 R D -2.4010
1235 D D -2.6236
1236 E D 0.0000
1237 L D -0.7013
1238 T D -1.2288
1239 K D -2.3566
1240 N D -2.4404
1241 Q D -1.9462
1242 V D 0.0000
1243 S D 0.0000
1244 L D 0.0000
1245 T D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 V D 0.0000
1249 K D -0.6788
1250 G D -1.1924
1251 F D 0.0000
1252 Y D -1.4376
1253 P D 0.0000
1254 S D -0.2003
1255 D D -1.1315
1256 I D 0.0000
1257 A D -0.7394
1258 V D 0.0000
1259 E D -1.5480
1260 W D 0.0000
1261 E D -1.9753
1262 S D 0.0000
1263 N D -2.1494
1264 G D -1.9037
1265 Q D -2.2247
1266 P D -2.0519
1267 E D -2.2468
1268 N D -2.1163
1269 N D -1.6102
1270 Y D -1.0564
1271 K D -0.7191
1272 T D -0.4256
1273 T D 0.0000
1274 P D 0.0571
1275 P D 0.3265
1276 V D 0.9192
1277 L D 1.0725
1278 D D -0.3244
1279 S D -1.2797
1280 D D -1.9809
1281 G D -0.8452
1282 S D 0.0000
1283 F D 0.1825
1284 F D 0.0000
1285 L D 0.0000
1286 Y D 0.0000
1287 S D 0.0000
1288 K D 0.0000
1289 L D 0.0000
1290 T D -0.7756
1291 V D 0.0000
1292 D D -2.2131
1293 K D -2.2901
1294 S D -1.9869
1295 R D -2.2672
1296 W D 0.0000
1297 Q D -2.6534
1298 Q D -2.6412
1299 G D -1.8443
1300 N D -1.4995
1301 V D -0.8503
1302 F D 0.0000
1303 S D -1.2343
1304 C D 0.0000
1305 S D -0.9125
1306 V D 0.0000
1307 M D -0.6906
1308 H D 0.0000
1309 E D -1.3123
1310 A D -2.0044
1311 L D 0.0000
1312 H D -1.7073
1313 N D -1.5934
1314 H D -1.0155
1315 Y D -0.3357
1316 T D -0.9525
1317 Q D -1.4145
1318 K D -1.2443
1319 S D -0.5356
1320 L D 0.0000
1321 S D -0.4175
1322 L D 0.5441
1323 S D -0.0907
1324 P D -0.5221
1325 G D -1.1652
1326 K D -1.7473

 

Laboratory of Theory of Biopolymers 2015