Project name: Valen_Histone_A_Stat

Status: done

submitted: 2018-05-31 11:52:48, status changed: 2018-05-31 12:00:41
Settings
Chain sequence(s) A: GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0758
Maximal score value
0.8567
Average score
-1.3241
Total score value
-156.246

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
715 G A -0.7380
716 S A -0.7195
717 H A -1.1920
718 M A -0.6185
719 S A -1.9820
720 K A -3.6105
721 E A -3.9926
722 P A -3.0059
723 R A -3.7676
724 D A -3.1202
725 P A -2.2896
726 D A -3.2336
727 Q A -2.9932
728 L A 0.0000
729 Y A -2.2524
730 S A -1.7055
731 T A -1.2923
732 L A 0.0000
733 K A -2.2045
734 S A -1.0958
735 I A 0.0000
736 L A 0.0000
737 Q A -1.9148
738 Q A -1.5037
739 V A 0.0000
740 K A -1.2698
741 S A -1.1156
742 H A -0.8979
743 Q A -0.9423
744 S A 0.0000
745 A A 0.0000
746 W A 0.5072
747 P A -0.0083
748 F A 0.0000
749 M A -0.8429
750 E A -1.9535
751 P A -1.6121
752 V A -1.6929
753 K A -3.1971
754 R A -3.2502
755 T A -2.6389
756 E A -2.8932
757 A A -2.1800
758 P A -1.4240
759 G A -1.4074
760 Y A 0.0000
761 Y A -1.4567
762 E A -2.0914
763 V A -0.7368
764 I A 0.0000
765 R A -1.2089
766 F A 0.8567
767 P A 0.1315
768 M A -0.1440
769 D A 0.0000
770 L A 0.0000
771 K A -2.5224
772 T A -2.0764
773 M A 0.0000
774 S A -2.7382
775 E A -3.7398
776 R A -3.2190
777 L A 0.0000
778 K A -4.0758
779 N A -3.5333
780 R A -3.4362
781 Y A -1.3785
782 Y A 0.0000
783 V A -1.2409
784 S A -1.2799
785 K A -2.0770
786 K A -2.3589
787 L A -0.4578
788 F A 0.0000
789 M A -1.0988
790 A A -0.6491
791 D A 0.0000
792 L A 0.0000
793 Q A -0.6413
794 R A -0.4934
795 V A 0.0000
796 F A 0.0000
797 T A -0.6533
798 N A 0.0000
799 C A 0.0000
800 K A -1.5490
801 E A -1.7194
802 Y A -0.5732
803 N A 0.0000
804 P A -1.5716
805 P A -2.1842
806 E A -2.7863
807 S A -1.9399
808 E A -2.5553
809 Y A -0.9948
810 Y A -1.5673
811 K A -2.1461
812 C A 0.0000
813 A A 0.0000
814 N A -0.6359
815 I A -0.2202
816 L A 0.0000
817 E A 0.0000
818 K A -1.1054
819 F A -0.2246
820 F A 0.0000
821 F A -0.8427
822 S A -1.3726
823 K A -1.5854
824 I A 0.0000
825 K A -3.4264
826 E A -3.2856
827 A A -2.4587
828 G A 0.0000
829 L A 0.0000
830 I A -2.8192
831 D A -3.5595
832 K A -2.7520

 

Laboratory of Theory of Biopolymers 2015