Project name: 2a8aaf3f6a77eb7

Status: done

submitted: 2017-11-14 10:16:31, status changed: 2017-11-14 11:41:39
Settings
Chain sequence(s) A: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCSPVQYLRWIFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCSPVQYLRWIFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.88
Maximal score value
2.1895
Average score
-0.7897
Total score value
-1047.145

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.5200
2 I A -0.4957
3 V A 0.0000
4 L A -0.5638
5 T A -1.1813
6 Q A -1.6811
7 S A -0.9556
8 P A 0.0000
9 G A -1.0127
10 T A -0.6744
11 L A -0.4064
12 S A -0.7635
13 L A 0.0000
14 S A -1.9097
15 P A -2.0483
16 G A -2.3494
17 E A -2.8747
18 R A -3.0656
19 A A 0.0000
20 T A -0.7420
21 L A 0.0000
22 S A -1.1051
23 C A 0.0000
24 R A -2.4009
25 A A 0.0000
26 S A -1.3304
27 Q A -1.8098
28 S A -1.3879
29 V A 0.0000
30 G A -0.0365
31 S A -0.3239
32 S A 0.3268
33 Y A 1.2272
34 L A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A -1.4682
40 K A -1.8940
41 P A -1.5086
42 G A -1.4451
43 Q A -2.2393
44 A A -1.6450
45 P A 0.0000
46 R A -2.0485
47 L A 0.0000
48 L A 0.0000
49 I A 0.0000
50 Y A 0.9441
51 G A 0.8514
52 A A 0.9332
53 F A 1.6682
54 S A 0.3770
55 R A -0.9916
56 A A -0.4716
57 T A -0.4924
58 G A -0.7786
59 I A -0.8117
60 P A -1.3413
61 D A -2.1514
62 R A -1.6584
63 F A 0.0000
64 S A -0.3323
65 G A 0.4339
66 S A 0.1225
67 G A -0.5655
68 S A -0.8532
69 G A -1.1160
70 T A -1.7373
71 D A -2.2005
72 F A 0.0000
73 T A -0.5995
74 L A 0.0000
75 T A -0.6806
76 I A 0.0000
77 S A -2.2978
78 R A -2.9369
79 L A 0.0000
80 E A -1.8337
81 P A -1.7041
82 E A -1.7145
83 D A 0.0000
84 F A 0.0000
85 A A 0.0000
86 V A -0.6180
87 Y A 0.0000
88 Y A 0.0000
89 C A 0.0000
90 S A 0.0000
91 P A 0.0000
92 V A 0.0000
93 Q A 0.3189
94 Y A 0.9181
95 L A 0.2731
96 R A -1.1993
97 W A -0.3404
98 I A -0.2598
99 F A 0.0000
100 G A 0.0000
101 Q A -1.6658
102 G A -1.3563
103 T A 0.0000
104 K A -1.2252
105 V A 0.0000
106 E A -1.2298
107 I A 0.0000
108 K A -1.5685
109 R A -1.6813
110 T A -0.1073
111 V A 1.0124
112 A A 0.4021
113 A A 0.1082
114 P A 0.0185
115 S A -0.3129
116 V A 0.0000
117 F A 0.0499
118 I A 0.0000
119 F A 0.0000
120 P A -0.3165
121 P A 0.0000
122 S A -1.4051
123 D A -2.4440
124 E A -2.6246
125 Q A 0.0000
126 L A 0.0000
127 K A -2.9445
128 S A -1.6982
129 G A -1.2406
130 T A -0.7873
131 A A 0.0000
132 S A 0.0000
133 V A 0.0000
134 V A 0.0000
135 C A 0.0000
136 L A 0.0000
137 L A 0.0000
138 N A 0.0000
139 N A -0.9874
140 F A 0.0000
141 Y A 0.0000
142 P A -1.7411
143 R A -3.2048
144 E A -3.3144
145 A A -2.5290
146 K A -2.5718
147 V A -1.4284
148 Q A -1.4011
149 W A 0.0000
150 K A -1.0615
151 V A 0.0000
152 D A -1.7347
153 N A -1.4746
154 A A -0.6943
155 L A -0.2350
156 Q A -1.3961
157 S A -1.0816
158 G A -1.3174
159 N A -1.9425
160 S A -1.5085
161 Q A 0.0000
162 E A -1.7849
163 S A -0.6520
164 V A -0.7500
165 T A -1.2467
166 E A -2.3574
167 Q A 0.0000
168 D A -3.0114
169 S A -2.5594
170 K A -3.0109
171 D A -3.2849
172 S A 0.0000
173 T A -2.0879
174 Y A 0.0000
175 S A 0.0000
176 L A -0.7270
177 S A 0.0000
178 S A 0.0000
179 T A 0.0000
180 L A 0.0000
181 T A -0.4979
182 L A -0.5593
183 S A -0.8806
184 K A -1.5027
185 A A -1.3671
186 D A -1.6639
187 Y A 0.0000
188 E A -2.3533
189 K A -2.9308
190 H A -2.5008
191 K A -2.6143
192 V A -1.1830
193 Y A 0.0000
194 A A 0.0000
195 C A 0.0000
196 E A -1.3673
197 V A 0.0000
198 T A -1.2701
199 H A 0.0000
200 Q A -1.7920
201 G A -0.4214
202 L A -0.1550
203 S A -0.4448
204 S A -0.3645
205 P A -0.5686
206 V A -0.1636
207 T A -0.7238
208 K A -1.0791
209 S A -0.7650
210 F A 0.0000
211 N A -1.1931
212 R A -1.6588
213 G A 0.0000
214 E A -1.5559
215 C A -1.4418
216 Q B -1.4046
217 V B -0.7151
218 Q B -1.2934
219 L B 0.0000
220 V B -0.1061
221 E B -0.3109
222 S B -0.6779
223 G B -0.8057
224 G B -0.4327
225 G B 0.2094
226 V B 0.4187
227 V B 0.0000
228 Q B -2.0242
229 P B -2.2064
230 G B -2.3276
231 R B -2.8174
232 S B -2.1267
233 L B -1.3643
234 R B -2.0869
235 L B 0.0000
236 S B -0.7011
237 C B 0.0000
238 A B -0.4244
239 A B 0.0000
240 S B -0.8426
241 G B -0.5889
242 F B 0.0368
243 T B -0.0501
244 F B 0.0000
245 S B -0.4776
246 S B 0.1256
247 Y B 0.6084
248 T B 0.1793
249 M B 0.0000
250 H B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B 0.0000
254 Q B -0.8793
255 A B -1.1519
256 P B -1.0532
257 G B -1.4916
258 K B -2.4909
259 G B -1.7723
260 L B -1.0741
261 E B -1.4721
262 W B 0.0000
263 V B 0.0000
264 T B 0.0000
265 F B 0.0000
266 I B 0.0000
267 S B 0.0000
268 Y B 0.2567
269 D B -1.0485
270 G B -1.4937
271 N B -1.9038
272 N B -1.5186
273 K B -0.7830
274 Y B 0.0334
275 Y B -0.8477
276 A B -1.5936
277 D B -2.9199
278 S B -2.2780
279 V B 0.0000
280 K B -2.9997
281 G B -2.3837
282 R B -3.1116
283 F B 0.0000
284 T B -1.3615
285 I B 0.0000
286 S B -0.5024
287 R B -0.8566
288 D B -1.5402
289 N B -1.4729
290 S B -1.5765
291 K B -2.3917
292 N B -1.8035
293 T B 0.0000
294 L B 0.0000
295 Y B -0.5410
296 L B 0.0000
297 Q B -1.7078
298 M B 0.0000
299 N B -2.3845
300 S B -2.0858
301 L B 0.0000
302 R B -3.2652
303 A B -2.0612
304 E B -2.4998
305 D B 0.0000
306 T B -0.6564
307 A B 0.0000
308 I B 0.4318
309 Y B 0.0000
310 Y B 0.0000
311 C B 0.0000
312 A B 0.0000
313 R B 0.0000
314 T B 0.3268
315 G B 0.5573
316 W B 1.3199
317 L B 1.0273
318 G B 0.0000
319 P B 0.5173
320 F B 0.0000
321 D B 0.0000
322 Y B 0.0388
323 W B 0.0000
324 G B 0.0000
325 Q B -1.3736
326 G B -0.6143
327 T B -0.0844
328 L B 0.4070
329 V B 0.0000
330 T B -0.0668
331 V B 0.0000
332 S B -0.8945
333 S B -0.6709
334 A B -0.7247
335 S B -0.8853
336 T B -1.1493
337 K B -2.1902
338 G B -1.6897
339 P B -0.9578
340 S B -0.6579
341 V B 0.0000
342 F B -0.6509
343 P B -1.2151
344 L B 0.0000
345 A B -0.9308
346 P B -0.7710
347 S B -1.0503
348 S B -1.5658
349 K B -1.9821
350 S B -1.4825
351 T B -0.9513
352 S B -0.9190
353 G B -0.7761
354 G B -0.7148
355 T B -0.5229
356 A B 0.0000
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.7186
364 D B -1.3267
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.7161
369 P B -0.7672
370 V B -0.8471
371 T B -0.5969
372 V B -0.3439
373 S B -0.3370
374 W B 0.0000
375 N B -0.7607
376 S B -0.6245
377 G B -0.3691
378 A B -0.1366
379 L B 0.1317
380 T B -0.0692
381 S B -0.1238
382 G B -0.2059
383 V B 0.3349
384 H B -0.1551
385 T B 0.0480
386 F B 0.0000
387 P B -0.2463
388 A B 0.3532
389 V B 0.6404
390 L B 0.9332
391 Q B -0.5281
392 S B -0.4202
393 S B -0.7731
394 G B -1.0296
395 L B 0.0000
396 Y B -0.1649
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0557
404 V B 0.0000
405 P B -0.5946
406 S B -0.6378
407 S B -0.7153
408 S B -0.8544
409 L B 0.0000
410 G B -1.2555
411 T B -0.9629
412 Q B -1.3862
413 T B -1.3919
414 Y B 0.0000
415 I B -1.5355
416 C B 0.0000
417 N B -1.6192
418 V B 0.0000
419 N B -2.0898
420 H B 0.0000
421 K B -2.7278
422 P B -1.6768
423 S B -1.9742
424 N B -2.5298
425 T B -2.1445
426 K B -2.7022
427 V B -1.8998
428 D B -2.7042
429 K B -2.2627
430 R B -2.8823
431 V B 0.0000
432 E B -2.9117
433 P B -2.1970
434 K B -2.4468
435 S B -1.6288
436 C B -1.5483
437 D B -2.1475
438 K B 0.0000
439 T B 0.0000
440 H B -1.7217
441 T B -1.3223
442 C B 0.0000
443 P B -1.2109
444 P B -0.9438
445 C B -0.6571
446 P B -0.7881
447 A B -0.8970
448 P B -0.8321
449 E B -1.2445
450 L B 0.4695
451 L B 1.1864
452 G B 0.1300
453 G B -0.0589
454 P B 0.0000
455 S B 0.0247
456 V B 0.0000
457 F B 1.2121
458 L B 1.0044
459 F B 1.4450
460 P B 0.1109
461 P B 0.0000
462 K B -1.9500
463 P B -1.1923
464 K B -1.0212
465 D B 0.0000
466 T B 0.0000
467 L B 0.0000
468 M B 0.6633
469 I B 1.6082
470 S B -0.0088
471 R B -1.2524
472 T B -0.6722
473 P B 0.0000
474 E B -1.0583
475 V B 0.0000
476 T B 0.6969
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.1888
481 D B -0.8625
482 V B 0.0000
483 S B -1.7729
484 H B -2.1506
485 E B -2.7477
486 D B 0.0000
487 P B -2.3189
488 E B -2.7446
489 V B 0.0000
490 K B -2.5157
491 F B 0.0000
492 N B -1.9474
493 W B 0.0000
494 Y B -1.3000
495 V B -0.8414
496 D B -1.8521
497 G B -0.7506
498 V B 0.6167
499 E B -0.9478
500 V B -0.1668
501 H B -1.4221
502 N B -1.3137
503 A B -1.0986
504 K B -2.1670
505 T B -1.5434
506 K B -2.4356
507 P B -2.1957
508 R B -3.6034
509 E B -3.4741
510 E B -3.2995
511 Q B -2.3949
512 Y B -0.7768
513 N B -1.1539
514 S B -1.0906
515 T B -1.3275
516 Y B -2.1288
517 R B -2.2137
518 V B 0.0000
519 V B -1.0194
520 S B 0.0000
521 V B -0.0025
522 L B 0.0000
523 T B -0.3555
524 V B 0.3934
525 L B 1.0149
526 H B -0.0491
527 Q B -1.2327
528 D B -1.1100
529 W B 0.0000
530 L B -0.9334
531 N B -2.0337
532 G B -2.0579
533 K B -2.1039
534 E B -2.1219
535 Y B 0.0000
536 K B -1.9236
537 C B 0.0000
538 K B -1.9520
539 V B 0.0000
540 S B -1.4637
541 N B -1.7848
542 K B -2.0448
543 A B -1.1914
544 L B -0.5380
545 P B -0.4262
546 A B -0.3773
547 P B -0.5789
548 I B -0.6175
549 E B -1.6864
550 K B -1.4012
551 T B -1.0981
552 I B 0.0310
553 S B -1.4374
554 K B -1.3369
555 A B -1.2593
556 K B -2.3344
557 G B -2.0900
558 Q B -2.1557
559 P B -2.2247
560 R B -2.7341
561 E B -2.7691
562 P B 0.0000
563 Q B -1.2279
564 V B 0.0000
565 Y B 0.0000
566 T B -0.4680
567 L B -0.1133
568 P B -0.4304
569 P B -0.9184
570 S B -1.3495
571 R B -2.6126
572 D B -2.7731
573 E B 0.0000
574 L B -1.3333
575 T B -1.4459
576 K B -2.3697
577 N B -2.6387
578 Q B -2.5806
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B 0.0000
587 G B -0.9691
588 F B 0.0000
589 Y B -1.3080
590 P B 0.0000
591 S B -0.0329
592 D B -0.7860
593 I B 0.0000
594 A B -0.5192
595 V B 0.0000
596 E B -1.2522
597 W B 0.0000
598 E B -1.9640
599 S B 0.0000
600 N B -2.3340
601 G B -1.9260
602 Q B -2.3055
603 P B -2.1730
604 E B -2.5922
605 N B -2.2783
606 N B -1.7538
607 Y B -1.1416
608 K B -0.8091
609 T B -0.4419
610 T B 0.0000
611 P B -0.0436
612 P B 0.2088
613 V B 0.5299
614 L B 0.6228
615 D B 0.0000
616 S B -1.2579
617 D B -1.8883
618 G B -0.7813
619 S B 0.0000
620 F B 0.1691
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -1.0231
628 V B 0.0000
629 D B -3.0858
630 K B -2.9894
631 S B -2.7539
632 R B -3.6757
633 W B 0.0000
634 Q B -3.2089
635 Q B -3.1133
636 G B -2.3615
637 N B -1.9967
638 V B -1.2585
639 F B 0.0000
640 S B -1.1326
641 C B 0.0000
642 S B 0.0000
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.1314
647 A B -1.8798
648 L B 0.0000
649 H B -1.7775
650 N B -1.6857
651 H B -1.1589
652 Y B -0.4480
653 T B -0.9366
654 Q B -1.1075
655 K B -1.1111
656 S B -0.5473
657 L B -0.3947
658 S B -1.0328
659 L B 0.0000
660 S B -1.2132
661 P B -1.4187
662 G B -2.5646
663 K B -2.5559
664 E C -1.2122
665 I C 0.2359
666 V C 0.0000
667 L C -0.6700
668 T C -1.5557
669 Q C -1.8310
670 S C -0.9576
671 P C 0.0000
672 G C -1.0920
673 T C -0.5370
674 L C -0.3008
675 S C -0.8256
676 L C -1.6066
677 S C -2.2583
678 P C -2.4235
679 G C -2.5764
680 E C -3.0002
681 R C -3.1899
682 A C 0.0000
683 T C -0.7355
684 L C 0.0000
685 S C 0.0000
686 C C 0.0000
687 R C -2.4842
688 A C 0.0000
689 S C -1.1610
690 Q C -1.8983
691 S C -1.5484
692 V C 0.0000
693 G C -0.1236
694 S C -0.3783
695 S C 0.0893
696 Y C 1.1655
697 L C 0.0000
698 A C 0.0000
699 W C 0.0000
700 Y C 0.0000
701 Q C -0.8412
702 Q C -1.0869
703 K C -1.4105
704 P C -1.1844
705 G C -1.5212
706 Q C -2.0488
707 A C -1.4262
708 P C 0.0000
709 R C -1.6677
710 L C 0.0000
711 L C 0.0000
712 I C 0.0000
713 Y C 0.5872
714 G C 0.5737
715 A C 0.2456
716 F C 0.3281
717 S C -0.2333
718 R C -0.9428
719 A C -0.4051
720 T C -0.4456
721 G C -0.7203
722 I C -0.7102
723 P C -1.1747
724 D C -2.0711
725 R C -1.7560
726 F C 0.0000
727 S C -0.5461
728 G C 0.0000
729 S C -0.4195
730 G C -0.9229
731 S C -0.9509
732 G C -1.2170
733 T C -1.8972
734 D C -2.3459
735 F C 0.0000
736 T C -0.8340
737 L C 0.0000
738 T C -0.7102
739 I C 0.0000
740 S C -2.4820
741 R C -3.3805
742 L C 0.0000
743 E C -2.0663
744 P C -1.9255
745 E C -2.2258
746 D C 0.0000
747 F C 0.0000
748 A C 0.0000
749 V C -0.1105
750 Y C 0.0000
751 Y C 0.0000
752 C C 0.0000
753 S C 0.0000
754 P C 0.0000
755 V C 0.4324
756 Q C 0.0944
757 Y C 0.8394
758 L C 0.3161
759 R C -0.9930
760 W C -0.1931
761 I C 0.0544
762 F C 0.0000
763 G C 0.0000
764 Q C -1.4658
765 G C -1.1855
766 T C 0.0000
767 K C -0.6244
768 V C 0.0000
769 E C 0.0000
770 I C 0.0000
771 K C -2.2732
772 R C -2.4711
773 T C -0.5335
774 V C 0.8022
775 A C 0.2870
776 A C 0.0912
777 P C -0.1497
778 S C -0.3356
779 V C 0.0000
780 F C 0.0795
781 I C 0.0000
782 F C 0.0000
783 P C -0.7444
784 P C 0.0000
785 S C 0.0000
786 D C -2.5244
787 E C -2.0528
788 Q C 0.0000
789 L C -1.9627
790 K C -2.5118
791 S C -1.5529
792 G C -1.1418
793 T C -0.9455
794 A C 0.0000
795 S C 0.0000
796 V C 0.0000
797 V C 0.0000
798 C C 0.0000
799 L C 0.0000
800 L C 0.0000
801 N C 0.0000
802 N C -1.0533
803 F C 0.0000
804 Y C 0.0000
805 P C -1.5035
806 R C -2.2098
807 E C -2.9213
808 A C -2.3372
809 K C -2.4549
810 V C -1.3999
811 Q C -1.1951
812 W C 0.0000
813 K C -0.5473
814 V C -0.8029
815 D C -1.4126
816 N C -1.2761
817 A C -0.3003
818 L C 0.3819
819 Q C -1.0210
820 S C -0.8168
821 G C -1.2592
822 N C -2.0226
823 S C -1.6103
824 Q C -1.2786
825 E C -1.5558
826 S C 0.0000
827 V C 0.6269
828 T C -0.3970
829 E C -1.8955
830 Q C 0.0000
831 D C -2.5528
832 S C -2.4394
833 K C -2.7838
834 D C -2.9395
835 S C 0.0000
836 T C 0.0000
837 Y C 0.0000
838 S C 0.0000
839 L C 0.0000
840 S C 0.0000
841 S C 0.0000
842 T C 0.0000
843 L C 0.0000
844 T C -0.5962
845 L C -0.7062
846 S C -1.3308
847 K C -2.2705
848 A C -2.1872
849 D C -2.5358
850 Y C 0.0000
851 E C -3.8800
852 K C -3.6418
853 H C -3.1564
854 K C -3.2528
855 V C -1.3447
856 Y C 0.0000
857 A C -0.7374
858 C C 0.0000
859 E C -0.9672
860 V C 0.0000
861 T C -1.1796
862 H C 0.0000
863 Q C -1.6780
864 G C -0.3728
865 L C -0.0485
866 S C -0.3939
867 S C -0.3291
868 P C -0.4782
869 V C 0.0076
870 T C -0.4466
871 K C -0.6884
872 S C -0.5730
873 F C 0.0000
874 N C -1.9113
875 R C -2.9381
876 G C -1.9755
877 E C -1.9080
878 C C -0.5753
879 Q D -1.3059
880 V D -0.5633
881 Q D -0.8341
882 L D 0.0000
883 V D 0.6338
884 E D 0.0000
885 S D -0.4368
886 G D -0.8101
887 G D -0.4768
888 G D 0.0769
889 V D 0.3925
890 V D -0.5952
891 Q D -1.7757
892 P D -2.0844
893 G D -2.2691
894 R D -2.7292
895 S D -2.0891
896 L D -1.5260
897 R D -2.2059
898 L D 0.0000
899 S D -0.5979
900 C D 0.0000
901 A D -0.1611
902 A D 0.0000
903 S D -0.7517
904 G D -0.7086
905 F D -0.0501
906 T D -0.0805
907 F D 0.0000
908 S D -0.9047
909 S D -0.2394
910 Y D 0.2553
911 T D 0.0000
912 M D 0.0000
913 H D 0.0000
914 W D 0.0000
915 V D 0.0000
916 R D 0.0000
917 Q D -0.7778
918 A D -1.1463
919 P D -1.0825
920 G D -1.4692
921 K D -2.3907
922 G D -1.5794
923 L D -0.8284
924 E D -0.9207
925 W D 0.0000
926 V D 0.0000
927 T D 0.0000
928 F D 0.0349
929 I D 0.0000
930 S D -1.1344
931 Y D -0.7317
932 D D -2.2541
933 G D -2.1870
934 N D -2.5778
935 N D -2.3699
936 K D -1.4850
937 Y D -0.0570
938 Y D -0.1265
939 A D -1.2336
940 D D -2.6794
941 S D -2.1018
942 V D 0.0000
943 K D -2.6444
944 G D -2.1761
945 R D -2.9597
946 F D 0.0000
947 T D -1.2821
948 I D 0.0000
949 S D -0.7963
950 R D -1.1110
951 D D -1.8214
952 N D -1.8352
953 S D -1.6489
954 K D -2.4535
955 N D -1.8481
956 T D -1.0357
957 L D 0.0000
958 Y D -0.6028
959 L D 0.0000
960 Q D -1.7701
961 M D 0.0000
962 N D -2.3107
963 S D -2.1135
964 L D 0.0000
965 R D -3.2444
966 A D -2.0267
967 E D -2.4883
968 D D 0.0000
969 T D -0.6560
970 A D 0.0000
971 I D 0.3969
972 Y D 0.0000
973 Y D 0.0000
974 C D 0.0000
975 A D 0.0000
976 R D 0.0000
977 T D 0.7708
978 G D 0.0000
979 W D 1.9398
980 L D 2.1073
981 G D 0.0000
982 P D 0.9433
983 F D 0.0000
984 D D 0.1197
985 Y D 0.1053
986 W D 0.0000
987 G D 0.0000
988 Q D -0.9999
989 G D 0.0000
990 T D 0.1258
991 L D 0.5287
992 V D 0.0000
993 T D -0.0416
994 V D 0.0000
995 S D -0.8029
996 S D -0.5934
997 A D -0.4628
998 S D -0.6228
999 T D -0.7050
1000 K D -1.2670
1001 G D -1.3285
1002 P D -0.6703
1003 S D -0.4047
1004 V D 0.0000
1005 F D -0.6242
1006 P D -1.2769
1007 L D 0.0000
1008 A D 0.0000
1009 P D -0.6038
1010 S D 0.0000
1011 S D -1.0376
1012 K D -1.7074
1013 S D -1.0566
1014 T D -0.8798
1015 S D -0.8602
1016 G D -0.7757
1017 G D -0.7115
1018 T D -0.5124
1019 A D 0.0000
1020 A D 0.0000
1021 L D 0.0000
1022 G D 0.0000
1023 C D 0.0000
1024 L D 0.0000
1025 V D 0.0000
1026 K D -0.4527
1027 D D -0.7545
1028 Y D 0.0000
1029 F D 0.0000
1030 P D 0.0000
1031 E D -0.7449
1032 P D -0.8427
1033 V D -0.7166
1034 T D -0.6343
1035 V D 0.0125
1036 S D -0.3018
1037 W D 0.0000
1038 N D -0.7115
1039 S D -0.5842
1040 G D -0.3157
1041 A D -0.1216
1042 L D 0.1061
1043 T D -0.0581
1044 S D -0.0912
1045 G D -0.1742
1046 V D 0.3422
1047 H D -0.0004
1048 T D 0.1731
1049 F D 0.0000
1050 P D -0.0296
1051 A D 0.1469
1052 V D 0.2295
1053 L D 0.4439
1054 Q D -0.8605
1055 S D -0.5526
1056 S D -0.5105
1057 G D 0.0000
1058 L D -0.2126
1059 Y D -0.0618
1060 S D 0.0000
1061 L D 0.0000
1062 S D 0.0000
1063 S D 0.0000
1064 V D 0.0000
1065 V D 0.0000
1066 T D -0.0578
1067 V D 0.0000
1068 P D -0.5674
1069 S D -0.5930
1070 S D -0.6920
1071 S D -0.7893
1072 L D -0.9346
1073 G D -1.2006
1074 T D -0.9209
1075 Q D -1.3853
1076 T D -1.3364
1077 Y D 0.0000
1078 I D -1.4229
1079 C D 0.0000
1080 N D -1.6062
1081 V D 0.0000
1082 N D -2.1476
1083 H D 0.0000
1084 K D -2.7523
1085 P D -1.6346
1086 S D -1.8432
1087 N D -2.5190
1088 T D -2.1710
1089 K D -2.7376
1090 V D -1.8847
1091 D D -2.7388
1092 K D -2.3696
1093 R D -2.9487
1094 V D 0.0000
1095 E D -2.6737
1096 P D -1.5702
1097 K D -1.1913
1098 S D -1.1135
1099 C D -0.4926
1100 D D -1.6392
1101 K D -2.2057
1102 T D 0.0000
1103 H D -1.4563
1104 T D -1.1606
1105 C D -1.2745
1106 P D -1.3070
1107 P D -1.1054
1108 C D 0.0000
1109 P D -0.6733
1110 A D -0.9290
1111 P D -0.8456
1112 E D -1.4876
1113 L D -0.2245
1114 L D 1.1473
1115 G D -0.0132
1116 G D -0.1226
1117 P D -0.2042
1118 S D 0.2656
1119 V D 0.8575
1120 F D 2.1895
1121 L D 0.0000
1122 F D 2.0666
1123 P D 0.5320
1124 P D 0.0000
1125 K D -1.9992
1126 P D -1.4232
1127 K D -1.2307
1128 D D -1.3710
1129 T D 0.0000
1130 L D 0.0000
1131 M D 0.6471
1132 I D 1.4690
1133 S D -0.0258
1134 R D -1.3048
1135 T D -0.6626
1136 P D 0.0000
1137 E D -0.7504
1138 V D 0.0000
1139 T D 1.0610
1140 C D 0.0000
1141 V D 0.9282
1142 V D 0.0000
1143 V D 0.1827
1144 D D -0.4611
1145 V D 0.0000
1146 S D -1.5148
1147 H D -2.2351
1148 E D -2.7220
1149 D D 0.0000
1150 P D -2.0748
1151 E D -2.3231
1152 V D 0.0000
1153 K D -2.2185
1154 F D 0.0000
1155 N D -1.6856
1156 W D 0.0000
1157 Y D -0.9084
1158 V D -0.6175
1159 D D -1.7203
1160 G D -0.5102
1161 V D 1.0857
1162 E D -0.0391
1163 V D 0.3870
1164 H D -1.1772
1165 N D -1.0935
1166 A D -1.0247
1167 K D -2.2121
1168 T D -1.3092
1169 K D -1.9439
1170 P D -2.1421
1171 R D -3.0085
1172 E D -2.9495
1173 E D -3.1714
1174 Q D -2.0279
1175 Y D -1.0010
1176 N D -0.9025
1177 S D -0.9742
1178 T D 0.0000
1179 Y D -1.8026
1180 R D -1.8117
1181 V D 0.0000
1182 V D -0.7278
1183 S D 0.0000
1184 V D 0.1980
1185 L D 0.0000
1186 T D -0.2224
1187 V D 0.5366
1188 L D 1.1312
1189 H D 0.0466
1190 Q D -0.8260
1191 D D -1.0016
1192 W D 0.0000
1193 L D -0.7798
1194 N D -1.9069
1195 G D -1.9055
1196 K D -2.0512
1197 E D -2.4249
1198 Y D 0.0000
1199 K D -2.0270
1200 C D 0.0000
1201 K D -1.8172
1202 V D 0.0000
1203 S D -1.2634
1204 N D -1.6534
1205 K D -2.0423
1206 A D -1.2563
1207 L D -0.5360
1208 P D -0.4568
1209 A D -0.2873
1210 P D -0.4263
1211 I D -0.4402
1212 E D -1.6917
1213 K D -1.8060
1214 T D -1.4119
1215 I D -0.2396
1216 S D -1.6152
1217 K D -1.3869
1218 A D -1.2939
1219 K D -2.3085
1220 G D -2.1299
1221 Q D -2.2404
1222 P D -2.4145
1223 R D -3.1142
1224 E D -2.9826
1225 P D 0.0000
1226 Q D -1.4802
1227 V D 0.0000
1228 Y D 0.0000
1229 T D -0.7221
1230 L D -0.1601
1231 P D -0.4781
1232 P D 0.0000
1233 S D -0.8359
1234 R D -1.8468
1235 D D -1.5247
1236 E D 0.0000
1237 L D -0.3688
1238 T D -1.0302
1239 K D -2.2551
1240 N D -2.7290
1241 Q D -2.4863
1242 V D 0.0000
1243 S D 0.0000
1244 L D 0.0000
1245 T D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 V D 0.0000
1249 K D 0.0000
1250 G D -1.1019
1251 F D 0.0000
1252 Y D -1.4662
1253 P D 0.0000
1254 S D -0.3605
1255 D D -1.1406
1256 I D 0.0000
1257 A D -0.7285
1258 V D 0.0000
1259 E D -1.2570
1260 W D 0.0000
1261 E D -2.0075
1262 S D 0.0000
1263 N D -2.0507
1264 G D -1.9148
1265 Q D -2.2997
1266 P D -2.0767
1267 E D -2.3405
1268 N D -2.1389
1269 N D -1.6350
1270 Y D -1.0795
1271 K D -0.9410
1272 T D -0.5023
1273 T D 0.0000
1274 P D -0.0642
1275 P D 0.2091
1276 V D 0.6577
1277 L D 0.6781
1278 D D -0.4802
1279 S D -1.3414
1280 D D -1.9765
1281 G D -0.8743
1282 S D -0.7954
1283 F D 0.1383
1284 F D 0.0000
1285 L D 0.0000
1286 Y D 0.0000
1287 S D 0.0000
1288 K D 0.0000
1289 L D 0.0000
1290 T D 0.0000
1291 V D 0.0000
1292 D D -2.8190
1293 K D -2.7808
1294 S D -2.1324
1295 R D -2.2339
1296 W D -1.9525
1297 Q D -2.1805
1298 Q D -2.2689
1299 G D -1.3987
1300 N D -1.1045
1301 V D -0.3622
1302 F D 0.0000
1303 S D -1.1565
1304 C D 0.0000
1305 S D -0.8346
1306 V D 0.0000
1307 M D 0.0000
1308 H D 0.0000
1309 E D -1.2831
1310 A D -1.9980
1311 L D 0.0000
1312 H D -1.8024
1313 N D -1.6927
1314 H D -0.9393
1315 Y D -0.5303
1316 T D -1.0701
1317 Q D -1.3512
1318 K D -1.1513
1319 S D -0.4144
1320 L D 0.0000
1321 S D 0.0000
1322 L D 0.8698
1323 S D 0.1698
1324 P D -0.4750
1325 G D -0.6307
1326 K D -1.4212

 

Laboratory of Theory of Biopolymers 2015