Project name: 2cc679f933579b0

Status: done

submitted: 2019-01-11 16:36:37, status changed: 2019-01-11 16:50:52
Settings
Chain sequence(s) A: SKGEELFTGKVPILVEELDGDVNGHKFSVSSSGEGEGDATKGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSSHHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLKEFFVTAAGIT
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2334
Maximal score value
0.3239
Average score
-1.0696
Total score value
-241.7329

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 S A -1.9652
3 K A -2.4282
4 G A 0.0000
5 E A -1.9763
6 E A -2.3898
7 L A -1.1869
8 F A 0.0000
9 T A -1.1591
10 G A -1.5013
11 K A -2.2651
12 V A 0.0000
13 P A -1.4508
14 I A 0.0000
15 L A -1.0601
16 V A 0.0000
17 E A -2.0201
18 L A 0.0000
19 D A -3.4826
20 G A 0.0000
21 D A -3.0438
22 V A 0.0000
23 N A -2.1037
24 G A -1.7524
25 H A -2.2611
26 K A -3.0589
27 F A 0.0000
28 S A -1.7842
29 V A 0.0000
30 S A -1.0531
31 G A 0.0000
32 E A -2.1794
33 G A -1.7659
34 E A -1.8345
35 G A 0.0000
36 D A 0.0000
37 A A 0.0000
38 T A -1.6082
39 K A -2.2176
40 G A 0.0000
41 K A -1.6316
42 L A 0.0000
43 T A -1.0826
44 L A 0.0000
45 K A -1.3631
46 F A 0.0000
47 I A -1.1255
48 C A 0.0000
49 T A -0.7949
50 T A -1.1918
51 G A -1.7137
52 K A -2.3099
53 L A 0.0000
54 P A -1.1992
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0041
63 T A 0.0000
64 L A 0.0000
68 V A -0.0838
69 Q A -0.1867
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.7646
74 Y A 0.0000
75 P A -1.8117
76 D A -2.8657
77 H A -2.3095
78 M A 0.0000
79 K A -2.7614
80 R A -2.7562
81 H A -1.7254
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.1498
87 A A 0.0000
88 M A 0.0000
89 P A -1.5094
90 E A -1.9616
91 G A 0.0000
92 Y A 0.0000
93 V A -0.8622
94 Q A 0.0000
95 E A -1.9043
96 R A 0.0000
97 T A -0.9887
98 I A 0.0000
99 S A -1.0465
100 F A 0.0000
101 K A -2.1272
102 D A -2.7995
103 D A -2.6120
104 G A 0.0000
105 N A -1.4892
106 Y A 0.0000
107 K A -2.4737
108 T A 0.0000
109 R A -3.5209
110 A A 0.0000
111 E A -2.1706
112 V A 0.0000
113 K A -1.3513
114 F A -1.4127
115 E A -1.6417
116 G A -1.7092
117 D A -2.1173
118 T A -1.5289
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.4443
123 I A 0.0000
124 E A -4.2334
125 L A 0.0000
126 K A -3.4230
127 G A 0.0000
128 I A -1.2041
129 D A -2.2197
130 F A 0.0000
131 K A -3.8179
132 E A -3.8235
133 D A -3.3636
134 G A -2.6536
135 N A -2.0742
136 I A 0.0000
137 L A -1.6815
138 G A -1.8626
139 H A -1.3973
140 K A -1.9796
141 L A -1.4869
142 E A -1.7552
143 Y A -0.4712
144 N A -0.5365
145 Y A -0.8067
146 N A -1.2166
147 S A -1.2983
148 H A -1.4900
149 N A -1.3542
150 V A 0.0000
151 Y A 0.3239
152 I A 0.0000
153 T A -1.2562
154 A A -1.8806
155 D A -2.4868
156 K A -3.1364
157 Q A -3.1931
158 K A -3.4014
159 N A -2.4860
160 G A 0.0000
161 I A 0.0000
162 K A -1.2435
163 A A 0.0000
164 N A -1.0912
165 F A 0.0000
166 K A -2.0300
167 I A 0.0000
168 R A -1.7455
169 H A 0.0000
170 N A -1.4772
171 I A 0.0000
172 E A -3.2106
173 D A -3.0178
174 G A -1.9396
175 S A -1.0886
176 V A -0.5234
177 Q A 0.0000
178 L A -1.1806
179 A A 0.0000
180 D A -1.1732
181 H A 0.0000
182 Y A 0.0201
183 Q A 0.0000
184 Q A -1.4375
185 N A 0.0000
186 T A -0.8703
187 P A -0.8619
188 I A -0.2555
189 G A -1.2176
190 D A -2.0908
191 G A -1.5002
192 P A -0.9799
193 V A -0.5515
194 L A -0.2697
195 L A -0.1729
196 P A 0.0000
197 D A -2.4528
198 N A -1.7881
199 H A 0.0000
200 Y A -0.0970
201 L A 0.0000
202 S A -0.6838
203 T A -0.8605
204 Q A -1.4751
205 S A -0.9203
206 A A -0.5023
207 L A -0.4003
208 S A -0.9306
209 K A -1.8712
210 D A -2.1850
211 P A -1.8176
212 N A -2.4723
213 E A -2.6445
214 K A -3.1045
215 R A -3.2835
216 D A -2.2427
217 H A 0.0000
218 M A 0.0000
219 V A -0.8899
220 L A 0.0000
221 K A -1.1860
222 E A -0.7034
223 F A -0.2979
224 V A 0.0000
225 T A -0.8113
226 A A 0.0000
227 A A -0.3384
228 G A -0.4945
229 I A -0.4833
230 T A -0.1703

 

Laboratory of Theory of Biopolymers 2015