Project name: 310bb5eabfebe8c

Status: done

submitted: 2018-03-09 12:46:33, status changed: 2018-03-09 13:31:07
Settings
Chain sequence(s) A: IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETPSKQSISNSESGPRGVHFIFNKENF
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7411
Maximal score value
2.5348
Average score
-0.8265
Total score value
-134.7137

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A 2.5348
2 A A 1.6115
3 V A 0.8220
4 D A 0.2689
5 G A 0.0000
6 P A 0.8329
7 F A 1.9746
8 G A 0.0000
9 T A -0.2310
10 A A 0.0000
11 S A 0.0000
12 E A -1.7271
13 D A -1.7882
14 V A 0.0000
15 F A 0.0000
16 S A -1.4577
17 Y A -1.6901
18 E A -2.3805
19 V A 0.0000
20 V A 0.0000
21 M A 0.0000
22 L A 0.0000
23 V A 0.0000
24 G A 0.0000
25 A A 0.0817
26 G A 0.0315
27 I A 1.7126
28 G A 0.0000
29 V A 0.0000
30 T A 0.7213
31 P A 0.4795
32 F A 0.0000
33 A A -0.2107
34 S A -0.4239
35 I A 0.0000
36 L A 0.0000
37 K A -0.4123
38 S A 0.0000
39 V A 0.0000
40 W A 0.0000
41 Y A 0.8773
42 K A 0.1397
43 Y A 0.3112
44 C A 0.2987
45 N A -0.8475
46 N A -0.7482
47 A A -0.3840
48 T A -0.6136
49 N A -0.7301
50 L A -0.0846
51 K A -1.6209
52 L A 0.0000
53 K A -2.1791
54 K A -1.5013
55 I A 0.0000
56 Y A 0.0057
57 F A 0.0000
58 Y A 0.0000
59 W A 0.0000
60 L A 0.0000
61 C A 0.0000
62 R A -2.4460
63 D A -3.1899
64 T A -2.2276
65 H A -2.2487
66 A A -1.2936
67 F A -1.1811
68 E A -2.3914
69 W A -0.8612
70 F A 0.0000
71 A A -1.4263
72 D A -2.1342
73 L A 0.0000
74 L A 0.0000
75 Q A -1.5840
76 L A -0.5125
77 L A 0.0000
78 E A -1.6699
79 S A -1.5425
80 Q A -1.9860
81 M A 0.0000
82 Q A -3.1512
83 E A -3.7411
84 R A -3.4032
85 N A -3.1231
86 N A -2.3253
87 A A -1.8611
88 G A -1.1353
89 F A 0.0000
90 L A 0.0000
91 S A -0.6951
92 Y A -0.7236
93 N A -0.8928
94 I A -0.4497
95 Y A 0.0000
96 L A 0.0000
97 T A -0.8170
98 G A -0.8095
99 W A 0.7526
123 Q A -2.0429
124 K A -2.2313
125 T A -0.7059
126 L A 0.0541
127 Y A 1.0221
128 G A -0.3671
129 R A -1.7324
130 P A -1.8636
131 N A -2.7158
132 W A 0.0000
133 D A -3.3972
134 N A -3.2209
135 E A -2.3319
136 F A 0.0000
137 K A -2.9132
138 T A -1.9262
139 I A 0.0000
140 A A -2.0083
141 S A -1.5114
142 Q A -1.7730
143 H A -1.8025
144 P A -2.2688
145 N A -3.1215
146 T A -2.3995
147 R A -2.5011
148 I A 0.0000
149 G A 0.0000
150 V A 0.0000
151 F A 0.0000
152 L A -0.2961
153 C A -0.1487
154 G A -0.2707
155 P A -1.4099
156 E A -2.3531
157 A A -1.5822
158 L A 0.0000
159 A A -1.9960
160 E A -2.7488
161 T A -1.9407
162 P A 0.0000
163 S A -0.9396
164 K A -1.8182
165 Q A -1.3961
166 S A 0.0000
167 I A 1.0627
168 S A -0.3156
169 N A 0.0000
170 S A -0.9840
171 E A -2.4204
172 S A -1.7653
173 G A -1.8454
174 P A -1.8911
175 R A -3.0341
176 G A -2.8379
177 V A 0.0000
178 H A -1.7579
179 F A 0.0000
180 I A 0.2469
181 F A 0.0702
182 N A -0.9950
183 K A -1.9482
184 E A -1.4205
185 N A -1.1649
186 F A 0.3424

 

Laboratory of Theory of Biopolymers 2015