Project name: 32e96b9fd926787

Status: done

submitted: 2017-11-14 10:16:07, status changed: 2017-11-14 11:42:17
Settings
Chain sequence(s) A: DIVMTQSPLSVPVTPGEPVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLVSGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCGPQLTAKLGFGPGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIVMTQSPLSVPVTPGEPVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLVSGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCGPQLTAKLGFGPGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVQSGAEVKKPGETVKISCKASDYTFTYYGMNWVKQAPGQGLKWMGWIDTTTGEPTYAQKFQGRIAFSLETSASTAYLQIKSLKSEDTATYFCARRGPYNWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QVQLVQSGAEVKKPGETVKISCKASDYTFTYYGMNWVKQAPGQGLKWMGWIDTTTGEPTYAQKFQGRIAFSLETSASTAYLQIKSLKSEDTATYFCARRGPYNWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.853
Maximal score value
1.7218
Average score
-0.8333
Total score value
-1113.2276

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.5184
2 I A 0.3514
3 V A 0.0000
4 M A -0.2410
5 T A 0.0000
6 Q A -1.2023
7 S A -0.1985
8 P A 0.2005
9 L A 1.1189
10 S A 0.2887
11 V A -0.0165
12 P A -0.5643
13 V A 0.0000
14 T A -1.7696
15 P A -1.9226
16 G A -1.9908
17 E A -2.0741
18 P A -1.8907
19 V A 0.0000
20 S A -1.3322
21 I A 0.0000
22 S A -1.1723
23 C A 0.0000
24 R A -1.9811
25 S A 0.0000
26 S A -1.1878
27 K A -2.0421
28 S A -1.6321
29 L A 0.0000
30 L A -1.3018
31 H A -1.6195
32 S A -1.4786
33 N A -1.8020
34 G A -1.5826
35 N A -1.4830
36 T A -1.1994
37 Y A 0.0000
38 L A 0.0000
39 Y A 0.0000
40 W A 0.0000
41 F A 0.0000
42 L A 0.0000
43 Q A -1.0615
44 R A -1.4907
45 P A -1.3476
46 G A -1.3950
47 Q A -2.0759
48 S A -1.4927
49 P A 0.0000
50 Q A -1.4855
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A -0.8014
55 R A -1.9812
56 M A -0.8760
57 S A -0.8223
58 N A -1.2132
59 L A -0.4441
60 V A -0.2686
61 S A -0.2494
62 G A -0.4811
63 V A -0.4024
64 P A -1.0600
65 D A -1.8340
66 R A -1.8488
67 F A 0.0000
68 S A -1.2309
69 G A 0.0000
70 S A -0.8434
71 G A -0.6574
72 S A -0.8607
73 G A -1.1435
74 T A -1.3133
75 A A -1.0908
76 F A 0.0000
77 T A -0.9946
78 L A 0.0000
79 R A -2.2872
80 I A 0.0000
81 S A -2.2491
82 R A -2.8598
83 V A 0.0000
84 E A -2.3564
85 A A -1.8383
86 E A -2.2735
87 D A 0.0000
88 V A 0.0000
89 G A 0.0000
90 V A -0.2245
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 G A 0.0000
95 P A 0.0000
96 Q A -0.5715
97 L A -0.1876
98 T A -0.6124
99 A A -0.9823
100 K A -2.1063
101 L A 0.0000
102 G A -0.7567
103 F A 0.0000
104 G A 0.0000
105 P A -0.4325
106 G A -0.4541
107 T A 0.0000
108 K A -0.3476
109 L A 0.0000
110 E A -0.9946
111 L A 0.0000
112 K A -1.7050
113 R A -2.0231
114 T A -0.2558
115 V A 0.9506
116 A A 0.3493
117 A A 0.1304
118 P A -0.2263
119 S A -0.1365
120 V A 0.1731
121 F A 0.3127
122 I A 0.0000
123 F A 0.0000
124 P A 0.0000
125 P A 0.0000
126 S A 0.0000
127 D A -3.0793
128 E A -3.1828
129 Q A 0.0000
130 L A -2.0660
131 K A -3.1065
132 S A -1.7680
133 G A -1.1908
134 T A -0.8303
135 A A 0.0000
136 S A 0.0000
137 V A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 L A 0.0000
142 N A 0.0000
143 N A -0.9235
144 F A 0.0000
145 Y A 0.0000
146 P A -1.7779
147 R A -3.2262
148 E A -3.3147
149 A A -2.5171
150 K A -2.6955
151 V A -1.3111
152 Q A -1.0695
153 W A 0.0000
154 K A -0.5940
155 V A -0.7598
156 D A -1.4582
157 N A -1.2442
158 A A -0.3249
159 L A 0.3857
160 Q A -0.9917
161 S A -0.7916
162 G A -1.2411
163 N A -1.9399
164 S A -1.5351
165 Q A -1.2977
166 E A -2.0318
167 S A 0.0000
168 V A -0.8309
169 T A -1.1266
170 E A -2.2874
171 Q A -2.3869
172 D A -2.5105
173 S A -2.3831
174 K A -2.8546
175 D A -3.2205
176 S A 0.0000
177 T A -2.0181
178 Y A 0.0000
179 S A 0.0000
180 L A -0.6932
181 S A 0.0000
182 S A 0.0000
183 T A 0.0000
184 L A 0.0000
185 T A 0.0000
186 L A -0.6850
187 S A -1.1985
188 K A -1.7570
189 A A -1.8524
190 D A -2.7090
191 Y A 0.0000
192 E A -2.4573
193 K A -3.1759
194 H A -2.5220
195 K A -2.4125
196 V A -1.2065
197 Y A 0.0000
198 A A -0.7366
199 C A 0.0000
200 E A -0.9109
201 V A 0.0000
202 T A -1.1757
203 H A 0.0000
204 Q A -1.7896
205 G A -0.4243
206 L A -0.1379
207 S A -0.4292
208 S A -0.3493
209 P A -0.5258
210 V A 0.1107
211 T A -0.2264
212 K A -0.2456
213 S A -0.3393
214 F A -0.9219
215 N A -1.7379
216 R A -1.8022
217 G A -1.3978
218 E A -1.7285
219 C A -1.2711
220 Q B -1.8152
221 V B -1.6167
222 Q B -1.9166
223 L B 0.0000
224 V B -0.2215
225 Q B -0.4932
226 S B -0.9670
227 G B -1.2056
228 A B 0.0000
229 E B -1.8307
230 V B -1.0803
231 K B -1.8880
232 K B -2.7359
233 P B -2.5171
234 G B -2.6957
235 E B -3.0874
236 T B -2.4410
237 V B -1.9207
238 K B -2.0236
239 I B 0.0000
240 S B -0.8438
241 C B 0.0000
242 K B -1.2858
243 A B -1.0920
244 S B -1.5363
245 D B -2.2443
246 Y B -0.7015
247 T B 0.1509
248 F B 0.0000
249 T B 0.5605
250 Y B 1.5064
251 Y B 0.8254
252 G B 0.0000
253 M B 0.0000
254 N B 0.0000
255 W B 0.0000
256 V B 0.0000
257 K B -1.0211
258 Q B -1.3088
259 A B -1.3775
260 P B -0.9708
261 G B -1.2615
262 Q B -1.9493
263 G B -1.4445
264 L B 0.0000
265 K B -2.3466
266 W B 0.0000
267 M B 0.0000
268 G B 0.0000
269 W B -0.2441
270 I B 0.0000
271 D B -0.8199
272 T B -0.0447
273 T B -0.3785
274 T B -1.0377
275 G B -1.5580
276 E B -2.1647
277 P B -1.1179
278 T B -0.8030
279 Y B -0.9745
280 A B -1.8840
281 Q B -2.7966
282 K B -3.3758
283 F B 0.0000
284 Q B -2.5716
285 G B -2.1157
286 R B -2.8593
287 I B 0.0000
288 A B -1.0187
289 F B 0.0000
290 S B -0.4064
291 L B -0.3163
292 E B -1.0137
293 T B -0.2993
294 S B -0.4650
295 A B -0.5503
296 S B -0.6821
297 T B 0.0000
298 A B 0.0000
299 Y B -0.5316
300 L B 0.0000
301 Q B -1.5899
302 I B 0.0000
303 K B -3.1453
304 S B -2.4510
305 L B 0.0000
306 K B -3.5884
307 S B -2.4079
308 E B -2.8246
309 D B -2.0468
310 T B -1.3030
311 A B 0.0000
312 T B -0.6306
313 Y B 0.0000
314 F B 0.0000
315 C B 0.0000
316 A B 0.0000
317 R B -0.4959
318 R B -0.8328
319 G B -0.5128
320 P B -0.6837
321 Y B -0.1447
322 N B 0.0000
323 W B 0.0000
324 Y B 0.0000
325 F B -0.4760
326 D B -0.7704
327 V B -0.7167
328 W B 0.0000
329 G B 0.0000
330 Q B -1.4101
331 G B -0.8322
332 T B -0.7851
333 T B -0.9040
334 V B 0.0000
335 T B -1.0921
336 V B 0.0000
337 S B -1.2757
338 S B -0.9862
339 A B -0.6458
340 S B -0.7531
341 T B -0.8272
342 K B -1.3804
343 G B -1.4962
344 P B -0.8469
345 S B -0.6495
346 V B 0.0000
347 F B -0.6469
348 P B -1.0414
349 L B 0.0000
350 A B 0.0000
351 P B -0.6504
352 S B 0.0000
353 S B -1.1710
354 K B -1.8444
355 S B -1.4231
356 T B -0.9569
357 S B -0.9429
358 G B -0.7737
359 G B -0.7243
360 T B -0.5197
361 A B 0.0000
362 A B 0.0000
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.5661
369 D B -0.9631
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -1.0092
374 P B -0.8822
375 V B -0.6782
376 T B -0.5258
377 V B -0.3215
378 S B -0.3516
379 W B 0.0000
380 N B -0.6690
381 S B -0.6845
382 G B -0.4079
383 A B -0.1905
384 L B 0.0199
385 T B -0.1066
386 S B -0.1189
387 G B -0.2354
388 V B 0.3391
389 H B -0.0808
390 T B 0.0608
391 F B 0.0000
392 P B -0.2749
393 A B 0.3046
394 V B 0.5364
395 L B 1.0940
396 Q B -0.2359
397 S B -0.2470
398 S B -0.2986
399 G B 0.0000
400 L B -0.0799
401 Y B 0.0935
402 S B 0.0000
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0726
409 V B 0.0000
410 P B -0.5612
411 S B -0.6017
412 S B -0.6548
413 S B -0.7608
414 L B -0.8913
415 G B -1.1677
416 T B -0.9109
417 Q B -1.3742
418 T B -1.0917
419 Y B 0.0000
420 I B -0.7940
421 C B 0.0000
422 N B -1.4707
423 V B 0.0000
424 N B -1.9543
425 H B 0.0000
426 K B -2.4531
427 P B -1.7284
428 S B -1.8100
429 N B -2.4506
430 T B -2.0918
431 K B -2.5873
432 V B -1.6236
433 D B -2.2816
434 K B -1.4653
435 K B -1.4192
436 V B 0.0000
437 E B -2.2968
438 P B -1.6756
439 K B -1.7776
440 S B -1.0166
441 C B -1.1322
442 D B -1.0809
443 K B 0.0000
444 T B -1.0714
445 H B -1.4416
446 T B -0.9002
447 C B -0.9420
448 P B -0.8206
449 P B -0.6665
450 C B -0.4261
451 P B -0.7098
452 A B -0.4955
453 P B -0.5613
454 E B -0.7490
455 L B 1.4325
456 L B 1.6651
457 G B 0.3404
458 G B 0.0657
459 P B 0.0000
460 S B 0.0746
461 V B 0.0000
462 F B 0.8937
463 L B 0.0000
464 F B 1.4620
465 P B 0.0751
466 P B 0.0000
467 K B -2.0434
468 P B -1.5062
469 K B -1.2822
470 D B 0.0000
471 T B 0.0000
472 L B 0.0000
473 M B 0.6494
474 I B 1.7218
475 S B 0.2466
476 R B -0.6989
477 T B -0.1493
478 P B 0.0000
479 E B -0.5613
480 V B 0.0000
481 T B 0.8472
482 C B 0.0000
483 V B 0.0000
484 V B 0.0000
485 V B -0.0927
486 D B -0.8706
487 V B 0.0000
488 S B -1.9425
489 H B -2.1924
490 E B -2.9059
491 D B -2.4485
492 P B -2.5446
493 E B -2.9258
494 V B 0.0000
495 K B -2.4697
496 F B -1.9204
497 N B -1.4787
498 W B 0.0000
499 Y B -1.0755
500 V B -0.7933
501 D B -1.8691
502 G B -0.6850
503 V B 0.8440
504 E B -0.3657
505 V B 0.1602
506 H B -1.2296
507 N B -1.0772
508 A B -1.0634
509 K B -2.0873
510 T B 0.0000
511 K B -2.5943
512 P B -2.2806
513 R B -3.7939
514 E B -3.7921
515 E B -3.4561
516 Q B -2.4758
517 Y B -1.0264
518 N B -1.2909
519 S B -1.0304
520 T B -1.4593
521 Y B -2.3057
522 R B -2.1386
523 V B 0.0000
524 V B -0.9871
525 S B 0.0000
526 V B 0.3675
527 L B 0.0000
528 T B -0.0573
529 V B 0.4821
530 L B 1.0160
531 H B 0.0000
532 Q B -1.2330
533 D B -1.3110
534 W B 0.0000
535 L B -0.9748
536 N B -1.9945
537 G B -1.9382
538 K B -2.0057
539 E B -2.2925
540 Y B 0.0000
541 K B -1.9973
542 C B 0.0000
543 K B -1.9334
544 V B 0.0000
545 S B -1.5398
546 N B -1.8600
547 K B -2.1177
548 A B -1.2656
549 L B -0.5854
550 P B -0.4401
551 A B -0.4275
552 P B -0.6725
553 I B -0.7557
554 E B -2.0036
555 K B -1.8563
556 T B -1.4263
557 I B -0.2743
558 S B -1.5439
559 K B -1.3953
560 A B -1.2845
561 K B -2.2997
562 G B -2.0698
563 Q B -2.1200
564 P B -2.1783
565 R B -2.6434
566 E B -2.6432
567 P B 0.0000
568 Q B -1.4445
569 V B 0.0000
570 Y B 0.0000
571 T B -0.7298
572 L B -0.3271
573 P B -0.4749
574 P B 0.0000
575 S B -0.9615
576 R B -1.9712
577 D B -1.7597
578 E B 0.0000
579 L B -0.0669
580 T B -0.7099
581 K B -1.6802
582 N B -2.3158
583 Q B -2.3977
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B -0.6708
592 G B -1.1693
593 F B 0.0000
594 Y B -1.3682
595 P B 0.0000
596 S B -0.1555
597 D B -1.2508
598 I B 0.0000
599 A B -0.6393
600 V B -0.5094
601 E B -1.3895
602 W B 0.0000
603 E B -2.1320
604 S B 0.0000
605 N B -2.3197
606 G B -1.9497
607 Q B -2.3663
608 P B -2.2666
609 E B -2.6829
610 N B -2.3181
611 N B -1.7304
612 Y B -1.1457
613 K B -0.7708
614 T B -0.4159
615 T B 0.0000
616 P B 0.0089
617 P B 0.2068
618 V B 0.7979
619 L B 1.0386
620 D B -0.3649
621 S B -1.2474
622 D B -1.9479
623 G B -0.8209
624 S B 0.0000
625 F B 0.0000
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9759
633 V B 0.0000
634 D B -2.5461
635 K B -2.5386
636 S B -2.5571
637 R B -3.3822
638 W B 0.0000
639 Q B -3.2060
640 Q B -3.0625
641 G B -2.3116
642 N B -1.8782
643 V B -1.1766
644 F B 0.0000
645 S B -1.2518
646 C B 0.0000
647 S B -0.9806
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.4077
652 A B -1.8575
653 L B 0.0000
654 H B -1.8506
655 N B -1.7802
656 H B -1.3195
657 Y B -0.8053
658 T B -1.2270
659 Q B -1.5740
660 K B -1.3921
661 S B -0.7749
662 L B 0.0000
663 S B -1.0910
664 L B 0.0000
665 S B -1.1845
666 P B -1.3064
667 G B -2.1489
668 K B -2.5781
669 D C -1.4417
670 I C 0.4462
671 V C 0.0000
672 M C 0.0196
673 T C 0.0000
674 Q C -0.8997
675 S C -0.2298
676 P C 0.1388
677 L C 1.0558
678 S C 0.2169
679 V C -0.0339
680 P C -0.3493
681 V C 0.0000
682 T C -1.5314
683 P C -1.9422
684 G C -2.2228
685 E C -2.1942
686 P C -1.9758
687 V C 0.0000
688 S C -1.2879
689 I C 0.0000
690 S C 0.0000
691 C C 0.0000
692 R C -1.6644
693 S C 0.0000
694 S C -1.1359
695 K C -2.0271
696 S C -1.4685
697 L C 0.0000
698 L C -0.8885
699 H C -1.1593
700 S C -1.0854
701 N C -1.7794
702 G C -1.3580
703 N C -1.1991
704 T C 0.0000
705 Y C -0.2012
706 L C 0.0000
707 Y C 0.0000
708 W C 0.0000
709 F C 0.0000
710 L C -0.5739
711 Q C -1.2053
712 R C -2.0180
713 P C -1.4211
714 G C -1.4761
715 Q C -1.7575
716 S C -1.3276
717 P C 0.0000
718 Q C -1.2026
719 L C 0.0000
720 L C 0.0000
721 I C 0.0000
722 Y C -0.3705
723 R C -1.2449
724 M C -0.6131
725 S C -0.5420
726 N C -0.7021
727 L C -0.1972
728 V C -0.0824
729 S C -0.2085
730 G C -0.5055
731 V C -0.4062
732 P C -1.0613
733 D C -1.8550
734 R C -1.8844
735 F C 0.0000
736 S C -1.2663
737 G C -0.8694
738 S C -0.8229
739 G C -0.6220
740 S C -0.7067
741 G C -0.9280
742 T C -1.1657
743 A C -0.9426
744 F C 0.0000
745 T C -0.9852
746 L C 0.0000
747 R C -2.3367
748 I C 0.0000
749 S C -2.3494
750 R C -3.1260
751 V C 0.0000
752 E C -2.3030
753 A C -1.6131
754 E C -1.8696
755 D C 0.0000
756 V C -1.0104
757 G C 0.0000
758 V C -0.3216
759 Y C 0.0000
760 Y C 0.0000
761 C C 0.0000
762 G C 0.0000
763 P C 0.0000
764 Q C -0.3718
765 L C -0.0048
766 T C -0.3578
767 A C -0.7510
768 K C -1.5401
769 L C 0.0000
770 G C -0.4348
771 F C 0.0000
772 G C 0.0000
773 P C -0.3101
774 G C -0.3529
775 T C 0.0000
776 K C -0.5187
777 L C 0.0000
778 E C -0.6151
779 L C -0.9885
780 K C -0.9910
781 R C -0.9549
782 T C 0.2367
783 V C 1.1645
784 A C 0.4186
785 A C 0.0915
786 P C -0.1828
787 S C -0.1976
788 V C 0.1218
789 F C 0.3169
790 I C 0.0000
791 F C 0.0000
792 P C 0.0000
793 P C 0.0000
794 S C 0.0000
795 D C -2.7260
796 E C -2.3874
797 Q C 0.0000
798 L C -2.1509
799 K C -2.6473
800 S C -1.6437
801 G C -1.1588
802 T C -0.8867
803 A C 0.0000
804 S C 0.0000
805 V C 0.0000
806 V C 0.0000
807 C C 0.0000
808 L C 0.0000
809 L C 0.0000
810 N C 0.0000
811 N C -1.0541
812 F C 0.0000
813 Y C 0.0000
814 P C -1.6209
815 R C -3.1452
816 E C -3.3121
817 A C -2.5290
818 K C -2.4962
819 V C -1.2916
820 Q C -1.0789
821 W C 0.0000
822 K C -0.7011
823 V C -0.9071
824 D C -1.5251
825 N C -1.3433
826 A C -0.4185
827 L C 0.1946
828 Q C -1.1030
829 S C -0.8934
830 G C -1.2884
831 N C -1.9261
832 S C -1.5765
833 Q C -1.2291
834 E C -1.8741
835 S C 0.0000
836 V C -0.6607
837 T C -0.8539
838 E C -1.7432
839 Q C 0.0000
840 D C -2.3411
841 S C -2.2756
842 K C -2.6374
843 D C -2.6096
844 S C 0.0000
845 T C 0.0000
846 Y C 0.0000
847 S C 0.0000
848 L C 0.0000
849 S C 0.0000
850 S C 0.0000
851 T C 0.0000
852 L C 0.0000
853 T C 0.0000
854 L C -0.5776
855 S C -1.1882
856 K C -2.1459
857 A C -2.1334
858 D C -2.4842
859 Y C 0.0000
860 E C -3.8530
861 K C -3.6555
862 H C -3.1617
863 K C -3.1767
864 V C -1.2940
865 Y C 0.0000
866 A C -0.7689
867 C C 0.0000
868 E C -0.9138
869 V C 0.0000
870 T C -1.1642
871 H C 0.0000
872 Q C -1.7865
873 G C -0.4202
874 L C -0.1284
875 S C -0.4290
876 S C -0.3333
877 P C -0.4728
878 V C 0.1366
879 T C -0.2998
880 K C -0.4515
881 S C -0.4426
882 F C 0.0000
883 N C -1.6677
884 R C -2.2516
885 G C -1.9058
886 E C -1.4628
887 C C -1.0004
888 Q D -1.6893
889 V D -1.4427
890 Q D -1.9696
891 L D 0.0000
892 V D -0.7966
893 Q D 0.0000
894 S D -1.1052
895 G D -1.1409
896 A D 0.0000
897 E D -1.8835
898 V D -1.2170
899 K D -1.9498
900 K D -2.6548
901 P D -2.4049
902 G D -2.3357
903 E D -2.4208
904 T D -2.0386
905 V D -1.6713
906 K D -1.9540
907 I D 0.0000
908 S D -0.9901
909 C D 0.0000
910 K D -1.8243
911 A D 0.0000
912 S D -1.5895
913 D D -1.9688
914 Y D -0.4692
915 T D 0.2896
916 F D 0.0000
917 T D 0.6426
918 Y D 1.6162
919 Y D 0.9659
920 G D 0.0000
921 M D 0.0000
922 N D 0.0000
923 W D 0.0000
924 V D 0.0000
925 K D -0.8340
926 Q D -1.1403
927 A D -1.2973
928 P D -0.9675
929 G D -1.2401
930 Q D -1.8287
931 G D -1.2258
932 L D 0.0000
933 K D -1.3890
934 W D 0.0000
935 M D 0.0000
936 G D 0.0000
937 W D 0.0000
938 I D 0.0000
939 D D -0.8492
940 T D 0.0059
941 T D -0.3554
942 T D -1.0668
943 G D -1.5440
944 E D -2.2154
945 P D -1.2076
946 T D -0.8471
947 Y D -1.2389
948 A D 0.0000
949 Q D -2.8247
950 K D -3.3647
951 F D 0.0000
952 Q D -2.8701
953 G D -2.4400
954 R D -3.4921
955 I D 0.0000
956 A D -1.2140
957 F D 0.0000
958 S D -0.4200
959 L D -0.2698
960 E D -0.9687
961 T D -0.2797
962 S D -0.4464
963 A D -0.5705
964 S D -0.7464
965 T D -0.9060
966 A D 0.0000
967 Y D -0.6062
968 L D 0.0000
969 Q D -1.6662
970 I D 0.0000
971 K D -2.6658
972 S D -2.2290
973 L D 0.0000
974 K D -3.5302
975 S D -2.4428
976 E D -2.8348
977 D D -2.0361
978 T D -1.3434
979 A D 0.0000
980 T D -0.6475
981 Y D 0.0000
982 F D 0.0000
983 C D 0.0000
984 A D 0.0000
985 R D 0.0000
986 R D -1.1229
987 G D -0.8559
988 P D -0.7048
989 Y D -0.5217
990 N D 0.0000
991 W D 0.0000
992 Y D 0.0000
993 F D -0.5586
994 D D -0.6609
995 V D -0.4752
996 W D 0.0000
997 G D 0.0000
998 Q D -1.4079
999 G D -0.8324
1000 T D -0.8139
1001 T D -0.9069
1002 V D 0.0000
1003 T D -1.1460
1004 V D 0.0000
1005 S D -1.3508
1006 S D -1.0418
1007 A D -0.7349
1008 S D -0.8974
1009 T D -0.9255
1010 K D -1.5953
1011 G D -1.6032
1012 P D -0.7956
1013 S D -0.3856
1014 V D 0.0000
1015 F D -0.5755
1016 P D -1.1901
1017 L D 0.0000
1018 A D 0.0000
1019 P D 0.0000
1020 S D 0.0000
1021 S D -1.0672
1022 K D -1.8827
1023 S D -1.2264
1024 T D -0.9687
1025 S D -0.8905
1026 G D -0.7879
1027 G D -0.7332
1028 T D -0.5231
1029 A D 0.0000
1030 A D 0.0579
1031 L D 0.0000
1032 G D 0.0000
1033 C D 0.0000
1034 L D 0.0000
1035 V D 0.0000
1036 K D -0.3841
1037 D D -0.6937
1038 Y D 0.0000
1039 F D 0.0000
1040 P D 0.0000
1041 E D -1.0606
1042 P D -0.9563
1043 V D -0.7635
1044 T D -0.6082
1045 V D 0.0260
1046 S D -0.3222
1047 W D 0.0000
1048 N D -0.6857
1049 S D -0.6009
1050 G D -0.3250
1051 A D -0.1343
1052 L D 0.0676
1053 T D -0.0692
1054 S D -0.0907
1055 G D -0.1371
1056 V D 0.3495
1057 H D -0.1606
1058 T D 0.0264
1059 F D 0.0000
1060 P D -0.2480
1061 A D 0.1819
1062 V D 0.7099
1063 L D 1.4116
1064 Q D 0.2028
1065 S D -0.0036
1066 S D 0.1870
1067 G D -0.2706
1068 L D 0.0806
1069 Y D 0.0000
1070 S D 0.0000
1071 L D 0.0000
1072 S D 0.0000
1073 S D 0.0000
1074 V D 0.0000
1075 V D 0.0000
1076 T D -0.0638
1077 V D 0.0000
1078 P D -0.5667
1079 S D -0.5883
1080 S D -0.6638
1081 S D -0.7806
1082 L D -0.9172
1083 G D -1.1875
1084 T D -0.9176
1085 Q D -1.3421
1086 T D -1.2762
1087 Y D 0.0000
1088 I D -1.3399
1089 C D 0.0000
1090 N D -1.5683
1091 V D 0.0000
1092 N D -2.1108
1093 H D 0.0000
1094 K D -2.7769
1095 P D -1.9203
1096 S D -1.9306
1097 N D -2.5554
1098 T D -2.1753
1099 K D -2.7145
1100 V D -1.8102
1101 D D -2.6005
1102 K D -2.0375
1103 K D -2.5927
1104 V D 0.0000
1105 E D -2.5772
1106 P D -1.5112
1107 K D -1.3347
1108 S D -1.2506
1109 C D -0.7833
1110 D D -1.9758
1111 K D -1.5300
1112 T D -1.2188
1113 H D -1.0837
1114 T D -0.7552
1115 C D -0.6798
1116 P D -0.4427
1117 P D -0.4809
1118 C D -0.1701
1119 P D -0.6404
1120 A D 0.0000
1121 P D -0.8267
1122 E D -1.4226
1123 L D 0.2076
1124 L D 1.3823
1125 G D 0.0270
1126 G D -0.0756
1127 P D -0.1005
1128 S D -0.0787
1129 V D 0.0000
1130 F D 0.9548
1131 L D 0.0000
1132 F D 1.3080
1133 P D 0.0344
1134 P D 0.0000
1135 K D -2.0254
1136 P D -1.2575
1137 K D -0.9769
1138 D D -1.1224
1139 T D 0.0000
1140 L D 0.0000
1141 M D 0.7046
1142 I D 1.4791
1143 S D -0.0479
1144 R D -1.3138
1145 T D -0.6975
1146 P D 0.0000
1147 E D -1.2496
1148 V D 0.0000
1149 T D 0.5618
1150 C D 0.0000
1151 V D 0.3179
1152 V D 0.0000
1153 V D 0.0473
1154 D D -0.2608
1155 V D 0.0000
1156 S D -1.7232
1157 H D -2.3069
1158 E D -2.8538
1159 D D -2.2616
1160 P D -2.4407
1161 E D -2.8918
1162 V D 0.0000
1163 K D -2.5633
1164 F D 0.0000
1165 N D -1.9099
1166 W D 0.0000
1167 Y D -1.5129
1168 V D -1.0207
1169 D D -2.0930
1170 G D -0.9439
1171 V D 0.3759
1172 E D -1.3424
1173 V D -0.2654
1174 H D -1.4085
1175 N D -1.2939
1176 A D -1.1219
1177 K D -2.0670
1178 T D -1.4597
1179 K D -2.3379
1180 P D -2.1909
1181 R D -3.2478
1182 E D -2.5813
1183 E D -1.9839
1184 Q D -1.4988
1185 Y D -0.6369
1186 N D -0.7012
1187 S D -0.7623
1188 T D 0.0000
1189 Y D -1.3480
1190 R D -1.5255
1191 V D 0.0000
1192 V D -0.7474
1193 S D 0.0000
1194 V D -0.1426
1195 L D 0.0000
1196 T D -0.4354
1197 V D 0.3709
1198 L D 1.0464
1199 H D 0.0000
1200 Q D -0.9064
1201 D D -1.1001
1202 W D 0.0000
1203 L D -1.0117
1204 N D -1.9615
1205 G D -2.0278
1206 K D -2.0611
1207 E D -2.1246
1208 Y D 0.0000
1209 K D -2.1020
1210 C D 0.0000
1211 K D -2.0573
1212 V D 0.0000
1213 S D -1.5145
1214 N D -1.8552
1215 K D -2.0799
1216 A D -1.2778
1217 L D -0.6399
1218 P D -0.5068
1219 A D -0.3743
1220 P D -0.5697
1221 I D -0.6717
1222 E D -1.9071
1223 K D -1.5668
1224 T D -1.2501
1225 I D -0.1065
1226 S D -1.4467
1227 K D -1.4094
1228 A D -1.2741
1229 K D -2.3050
1230 G D -2.1146
1231 Q D -2.2068
1232 P D -2.3142
1233 R D -2.9741
1234 E D -2.7606
1235 P D 0.0000
1236 Q D -1.3223
1237 V D 0.0000
1238 Y D 0.0000
1239 T D -0.6658
1240 L D 0.0000
1241 P D -0.5417
1242 P D 0.0000
1243 S D -1.2706
1244 R D -2.4317
1245 D D -2.6122
1246 E D 0.0000
1247 L D -0.9313
1248 T D -1.3102
1249 K D -2.4048
1250 N D -2.5212
1251 Q D -2.1781
1252 V D 0.0000
1253 S D 0.0000
1254 L D 0.0000
1255 T D 0.0000
1256 C D 0.0000
1257 L D 0.0000
1258 V D 0.0000
1259 K D 0.0000
1260 G D -1.0765
1261 F D 0.0000
1262 Y D -1.3735
1263 P D 0.0000
1264 S D -0.2154
1265 D D -0.9064
1266 I D 0.0000
1267 A D -0.4338
1268 V D 0.0000
1269 E D -1.1227
1270 W D 0.0000
1271 E D -2.0064
1272 S D 0.0000
1273 N D -2.1662
1274 G D -1.9424
1275 Q D -2.3433
1276 P D -2.2302
1277 E D -2.7740
1278 N D -2.3405
1279 N D -1.7718
1280 Y D -1.0940
1281 K D -0.5696
1282 T D -0.3479
1283 T D 0.0000
1284 P D -0.0079
1285 P D 0.2612
1286 V D 0.7261
1287 L D 0.8134
1288 D D -0.4060
1289 S D -1.3003
1290 D D -1.9483
1291 G D -0.8173
1292 S D -0.7385
1293 F D 0.1685
1294 F D 0.0000
1295 L D 0.0000
1296 Y D 0.0000
1297 S D 0.0000
1298 K D 0.0000
1299 L D 0.0000
1300 T D -0.8616
1301 V D -1.1299
1302 D D -2.3128
1303 K D -2.1860
1304 S D -1.9652
1305 R D -2.3135
1306 W D 0.0000
1307 Q D -2.7253
1308 Q D -2.6190
1309 G D -2.0975
1310 N D -1.6561
1311 V D -1.0645
1312 F D 0.0000
1313 S D -1.1095
1314 C D 0.0000
1315 S D -0.6798
1316 V D 0.0000
1317 M D -0.3571
1318 H D 0.0000
1319 E D -1.1180
1320 A D -1.8652
1321 L D 0.0000
1322 H D -1.6456
1323 N D -1.5484
1324 H D -0.6722
1325 Y D -0.0928
1326 T D -0.8284
1327 Q D -1.2583
1328 K D -1.2465
1329 S D -0.6928
1330 L D -0.4377
1331 S D -1.0616
1332 L D 0.0000
1333 S D -1.6265
1334 P D -1.7466
1335 G D -2.0851
1336 K D -2.4582

 

Laboratory of Theory of Biopolymers 2015