Project name: 33e2831b84ac497

Status: done

submitted: 2017-11-14 10:16:30, status changed: 2017-11-14 11:40:44
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYLVLYLIIGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYLVLYLIIGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGNTLPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLQESGPGLVRPSQTLSLTCTVSGYSITSDHAWSWVRQPPGRGLEWIGYISYSGITTYNPSLKSRVTMLRDTSKNQFSLRLSSVTAADTAVYYCARSLARTTAMDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.8039
Maximal score value
2.6647
Average score
-0.7165
Total score value
-948.6051

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.5304
2 I A 0.1933
3 Q A 0.0000
4 M A -0.5375
5 T A 0.0000
6 Q A -1.6541
7 S A -1.0630
8 P A -1.2862
9 S A -1.1445
10 S A -1.1081
11 L A -0.5766
12 S A -0.9669
13 A A 0.0000
14 S A -1.0191
15 V A 0.1039
16 G A -0.8001
17 D A -1.8169
18 R A -2.5795
19 V A 0.0000
20 T A -0.7436
21 I A 0.0000
22 T A -1.1352
23 C A 0.0000
24 R A -2.2197
25 A A 0.0000
26 S A -1.4578
27 Q A -2.7492
28 D A -2.9542
29 I A 0.0000
30 S A -0.7457
31 S A 0.1252
32 Y A 0.8177
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.9683
39 K A -2.8131
40 P A -2.0463
41 G A -1.8825
42 K A -2.8969
43 A A -1.9328
44 P A 0.0000
45 K A -1.8758
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 1.5804
50 L A 1.7881
51 V A 1.6325
52 L A 1.8099
53 Y A 2.5046
54 L A 2.1165
55 I A 1.8612
56 I A 2.3265
57 G A 0.7900
58 V A 0.6718
59 P A -0.5427
60 S A -1.0836
61 R A -2.2445
62 F A 0.0000
63 S A -0.1470
64 G A 0.0000
65 S A 0.0166
66 G A -0.6907
67 S A -1.0134
68 G A -1.7835
69 T A -2.2788
70 D A -2.5799
71 F A 0.0000
72 T A -0.7589
73 F A 0.0000
74 T A -0.8180
75 I A 0.0000
76 S A -1.9006
77 S A -1.5082
78 L A 0.0000
79 Q A -1.0146
80 P A -1.5380
81 E A -2.3037
82 D A 0.0000
83 I A -1.4132
84 A A 0.0000
85 T A -1.3893
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A -0.2223
92 N A -1.2823
93 T A -0.3479
94 L A 0.3634
95 P A 0.0277
96 Y A 0.0000
97 T A -0.3575
98 F A 0.0000
99 G A 0.0000
100 Q A -1.8127
101 G A -1.6253
102 T A 0.0000
103 K A -2.1358
104 V A 0.0000
105 E A -1.4600
106 I A 0.0000
107 K A -1.7138
108 R A -2.0323
109 T A -0.4602
110 V A 0.8402
111 A A 0.2921
112 A A 0.1080
113 P A -0.0180
114 S A -0.3215
115 V A 0.0000
116 F A 0.0941
117 I A 0.0000
118 F A 0.0000
119 P A -0.4769
120 P A 0.0000
121 S A -1.8689
122 D A -3.2882
123 E A -3.2515
124 Q A 0.0000
125 L A 0.0000
126 K A -3.1415
127 S A -1.8265
128 G A -1.2450
129 T A -0.8071
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -0.9547
139 F A 0.0000
140 Y A 0.0000
141 P A -1.8643
142 R A -3.2258
143 E A -3.3221
144 A A -2.5520
145 K A -2.7111
146 V A -1.3421
147 Q A -1.1110
148 W A 0.0000
149 K A -0.5774
150 V A -0.7623
151 D A -1.5125
152 N A -1.2333
153 A A -0.3320
154 L A 0.3370
155 Q A -1.0287
156 S A -0.8441
157 G A -1.2629
158 N A -1.9538
159 S A -1.5594
160 Q A -1.2437
161 E A -2.0320
162 S A -0.6860
163 V A -0.8457
164 T A -1.1734
165 E A -2.3237
166 Q A 0.0000
167 D A -2.4893
168 S A -2.2891
169 K A -2.5982
170 D A -2.5940
171 S A 0.0000
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5150
181 L A -0.5509
182 S A -0.9329
183 K A -1.5681
184 A A -1.5910
185 D A -1.8210
186 Y A 0.0000
187 E A -2.2561
188 K A -2.8811
189 H A -2.3356
190 K A -2.2859
191 V A -1.1046
192 Y A 0.0000
193 A A -0.8968
194 C A 0.0000
195 E A -0.9989
196 V A 0.0000
197 T A -1.1687
198 H A 0.0000
199 Q A -1.7728
200 G A -0.3748
201 L A -0.0450
202 S A -0.3960
203 S A -0.3384
204 P A -0.5022
205 V A -0.0410
206 T A -0.5518
207 K A -0.9167
208 S A -0.7532
209 F A 0.0000
210 N A -1.7760
211 R A -1.8161
212 G A -1.2669
213 E A -1.7977
214 C A -1.4987
215 Q B -0.8783
216 V B 0.4866
217 Q B -1.0426
218 L B 0.0000
219 Q B -1.7010
220 E B -1.0671
221 S B -0.8602
222 G B -0.4648
223 P B -0.0943
224 G B 0.0120
225 L B -0.1078
226 V B 0.0000
227 R B -2.2763
228 P B -1.5014
229 S B -1.4166
230 Q B -1.9401
231 T B -1.4720
232 L B -0.8913
233 S B -0.8277
234 L B 0.0000
235 T B -0.6714
236 C B 0.0000
237 T B -1.1304
238 V B 0.0000
239 S B -0.8260
240 G B -0.4808
241 Y B -0.0665
242 S B -0.5512
243 I B 0.0000
244 T B -0.9501
245 S B -0.8914
246 D B -2.1736
247 H B -1.3758
248 A B 0.0000
249 W B 0.0000
250 S B 0.0000
251 W B 0.0000
252 V B 0.0000
253 R B -0.6822
254 Q B -1.0936
255 P B -1.0848
256 P B -1.1496
257 G B -1.5749
258 R B -2.6527
259 G B -1.8974
260 L B 0.0000
261 E B -1.4531
262 W B 0.0000
263 I B 0.0000
264 G B 0.0000
265 Y B 0.0000
266 I B 0.0000
267 S B 0.0000
268 Y B -0.2366
269 S B 0.1119
270 G B 0.8565
271 I B 1.9672
272 T B 1.0463
273 T B 0.4357
274 Y B -0.3565
275 N B -0.7349
276 P B -1.2106
277 S B -1.0758
278 L B 0.0000
279 K B -2.3324
280 S B -1.6634
281 R B -2.1992
282 V B 0.0000
283 T B -1.0405
284 M B 0.0000
285 L B 0.0831
286 R B -0.6791
287 D B -1.5101
288 T B -1.3071
289 S B -1.5702
290 K B -2.5052
291 N B -2.0468
292 Q B -1.5740
293 F B 0.0000
294 S B -0.4543
295 L B 0.0000
296 R B -1.7426
297 L B 0.0000
298 S B -1.4200
299 S B -1.1794
300 V B 0.0000
301 T B -0.7368
302 A B -0.3853
303 A B -0.0745
304 D B -0.2695
305 T B 0.0549
306 A B 0.0000
307 V B 0.2640
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 R B 0.0000
313 S B 0.0000
314 L B 0.0000
315 A B -0.9296
316 R B -2.2005
317 T B 0.0000
318 T B -0.8020
319 A B -0.0871
320 M B 0.0000
321 D B -0.1468
322 Y B 0.1503
323 W B 0.0000
324 G B 0.0000
325 Q B -1.9397
326 G B -1.0028
327 S B -0.1973
328 L B 0.5903
329 V B 0.0000
330 T B -0.0716
331 V B 0.0000
332 S B -0.7601
333 S B -0.9318
334 A B -0.6996
335 S B -0.8736
336 T B -0.9510
337 K B -1.6825
338 G B -1.6761
339 P B -0.9241
340 S B -0.6709
341 V B 0.0000
342 F B -0.7574
343 P B -1.2265
344 L B 0.0000
345 A B -0.9023
346 P B -0.8041
347 S B -1.1878
348 S B -1.3859
349 K B -1.8485
350 S B -1.4540
351 T B -0.9618
352 S B -0.9648
353 G B -0.7766
354 G B -0.7131
355 T B -0.5381
356 A B 0.0000
357 A B 0.0084
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.5267
364 D B -1.0994
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.6491
369 P B -0.7580
370 V B -0.4831
371 T B -0.5276
372 V B 0.0599
373 S B -0.2606
374 W B 0.0000
375 N B -0.7442
376 S B -0.6164
377 G B -0.2911
378 A B -0.0702
379 L B 0.2948
380 T B 0.0452
381 S B -0.0071
382 G B -0.0720
383 V B 0.4343
384 H B -0.1006
385 T B 0.0500
386 F B 0.0000
387 P B -0.2422
388 A B 0.4763
389 V B 0.8399
390 L B 1.2955
391 Q B -0.1289
392 S B -0.2357
393 S B -0.4061
394 G B -0.1107
395 L B -0.0984
396 Y B 0.0000
397 S B 0.0000
398 L B 0.0000
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0176
404 V B 0.0000
405 P B -0.6035
406 S B -0.6436
407 S B -0.7250
408 S B -0.8756
409 L B 0.0000
410 G B -1.2619
411 T B -0.9787
412 Q B -1.4450
413 T B -1.2699
414 Y B 0.0000
415 I B -1.1467
416 C B 0.0000
417 N B -1.4956
418 V B 0.0000
419 N B -1.9603
420 H B 0.0000
421 K B -2.7128
422 P B -1.6786
423 S B -1.9043
424 N B -2.5354
425 T B -2.1581
426 K B -2.6729
427 V B -1.8079
428 D B -2.6188
429 K B -2.1119
430 K B -2.2391
431 V B 0.0000
432 E B -2.7584
433 P B -2.1621
434 K B -2.6712
435 S B -1.4795
436 C B -1.1052
437 D B -0.9417
438 K B 0.0000
439 T B -0.7959
440 H B -1.2079
441 T B -0.6927
442 C B 0.0000
443 P B -0.7952
444 P B -0.6483
445 C B -0.4278
446 P B -0.6972
447 A B -0.3767
448 P B -0.6434
449 E B -0.7202
450 L B 1.3134
451 L B 1.6618
452 G B 0.4463
453 G B -0.0190
454 P B 0.0000
455 S B 0.3642
456 V B 0.7885
457 F B 2.1937
458 L B 0.0000
459 F B 2.0819
460 P B 0.5226
461 P B 0.0000
462 K B -1.5842
463 P B -1.1295
464 K B -1.1059
465 D B 0.0000
466 T B 0.0000
467 L B 0.0000
468 M B 0.5374
469 I B 1.5617
470 S B -0.0229
471 R B -1.2583
472 T B -0.4666
473 P B 0.0000
474 E B -0.5978
475 V B 0.0000
476 T B 1.1351
477 C B 0.0000
478 V B 0.8768
479 V B 0.0000
480 V B -0.1648
481 D B -1.2897
482 V B 0.0000
483 S B -1.8452
484 H B -2.1451
485 E B -2.7385
486 D B 0.0000
487 P B -2.2267
488 E B -2.6731
489 V B 0.0000
490 K B -2.4719
491 F B -1.9437
492 N B -1.6036
493 W B 0.0000
494 Y B -1.4569
495 V B -0.9744
496 D B -2.1631
497 G B -0.9433
498 V B 0.5638
499 E B -0.9569
500 V B 0.1582
501 H B -1.1917
502 N B -1.1624
503 A B -1.1716
504 K B -2.2440
505 T B -1.7459
506 K B -2.9253
507 P B -2.3553
508 R B -3.4923
509 E B -3.2986
510 E B -3.0062
511 Q B -2.5422
512 Y B -1.4472
513 N B -1.4955
514 S B -1.3654
515 T B -1.6156
516 Y B -2.2668
517 R B -2.0511
518 V B 0.0000
519 V B -0.8817
520 S B 0.0000
521 V B 0.1738
522 L B 0.0000
523 T B -0.2349
524 V B 0.0000
525 L B 0.9850
526 H B -0.0864
527 Q B -1.2975
528 D B -1.0402
529 W B 0.0000
530 L B -0.9906
531 N B -2.0351
532 G B -2.1204
533 K B -2.2360
534 E B -2.4380
535 Y B 0.0000
536 K B -2.3303
537 C B 0.0000
538 K B -2.0857
539 V B 0.0000
540 S B -1.4451
541 N B -1.7338
542 K B -2.0544
543 A B -1.2005
544 L B -0.5119
545 P B -0.4055
546 A B -0.3800
547 P B -0.6048
548 I B -0.7069
549 E B -1.9473
550 K B -1.9586
551 T B -1.5695
552 I B 0.0000
553 S B -1.7220
554 K B -1.4469
555 A B -1.3067
556 K B -2.3183
557 G B -2.1034
558 Q B -2.1749
559 P B -2.2694
560 R B -2.9415
561 E B -2.9356
562 P B 0.0000
563 Q B -1.4868
564 V B 0.0000
565 Y B 0.0000
566 T B 0.0000
567 L B 0.0000
568 P B -0.3345
569 P B 0.0000
570 S B -1.2358
571 R B -2.4073
572 D B -2.5853
573 E B 0.0000
574 L B -0.6772
575 T B -1.1482
576 K B -2.1953
577 N B -2.4293
578 Q B -2.1198
579 V B 0.0000
580 S B 0.0000
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B -0.7536
587 G B -1.2535
588 F B 0.0000
589 Y B -1.4379
590 P B 0.0000
591 S B 0.0001
592 D B -0.7822
593 I B 0.0000
594 A B 0.0000
595 V B -0.3008
596 E B -0.9358
597 W B 0.0000
598 E B -1.8369
599 S B 0.0000
600 N B -2.1084
601 G B -1.8428
602 Q B -2.1972
603 P B -1.9587
604 E B -2.1972
605 N B -2.0570
606 N B -1.6348
607 Y B -0.9527
608 K B -0.6558
609 T B -0.3599
610 T B 0.0000
611 P B 0.0018
612 P B 0.2233
613 V B 0.6878
614 L B 0.8937
615 D B -0.4725
616 S B -1.3754
617 D B -2.0088
618 G B -0.9013
619 S B 0.0000
620 F B 0.0000
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.8462
628 V B 0.0000
629 D B -2.3749
630 K B -2.2785
631 S B -2.0805
632 R B -2.2954
633 W B -1.8794
634 Q B -2.4481
635 Q B -2.4336
636 G B -1.6103
637 N B -1.5197
638 V B -0.7759
639 F B 0.0000
640 S B -1.0792
641 C B 0.0000
642 S B 0.0000
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.2104
647 A B -1.9468
648 L B 0.0000
649 H B -1.8342
650 N B -1.7438
651 H B -1.2682
652 Y B -0.6434
653 T B -1.1222
654 Q B -1.3134
655 K B -1.3067
656 S B -0.6849
657 L B -0.1643
658 S B -0.6192
659 L B 0.0000
660 S B -0.8691
661 P B -0.7448
662 G B -1.0651
663 D C -1.1600
664 I C 0.7016
665 Q C 0.0000
666 M C -0.4541
667 T C 0.0000
668 Q C -1.4564
669 S C -0.8226
670 P C -1.0103
671 S C -0.9147
672 S C -0.8048
673 L C -0.5472
674 S C -1.0828
675 A C 0.0000
676 S C -0.9522
677 V C 0.2597
678 G C -0.7722
679 D C -2.0505
680 R C -2.3994
681 V C 0.0000
682 T C -0.7019
683 I C 0.0000
684 T C -0.9998
685 C C 0.0000
686 R C -2.0680
687 A C 0.0000
688 S C -1.3098
689 Q C -2.5095
690 D C -2.9844
691 I C 0.0000
692 S C -0.7523
693 S C 0.2881
694 Y C 0.9582
695 L C 0.0000
696 N C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C -1.1855
700 Q C -1.8945
701 K C -2.8780
702 P C -2.0689
703 G C -1.9171
704 K C -2.9057
705 A C -1.8688
706 P C 0.0000
707 K C -1.4576
708 L C 0.0000
709 L C 0.0000
710 I C 0.0000
711 Y C 1.7400
712 L C 2.0226
713 V C 1.7000
714 L C 2.0550
715 Y C 2.6647
716 L C 2.1485
717 I C 1.9043
718 I C 2.2617
719 G C 0.7371
720 V C 0.8131
721 P C 0.0864
722 S C -0.3460
723 R C -0.7293
724 F C 0.0000
725 S C 0.3184
726 G C 0.0000
727 S C 0.1227
728 G C -0.5423
729 S C -0.7548
730 G C 0.0000
731 T C -2.1440
732 D C -2.5217
733 F C 0.0000
734 T C -0.6409
735 F C 0.0000
736 T C -0.5327
737 I C 0.0000
738 S C -1.2957
739 S C -1.1194
740 L C 0.0000
741 Q C -0.7685
742 P C -1.3332
743 E C -1.9911
744 D C 0.0000
745 I C -1.2912
746 A C 0.0000
747 T C -1.1085
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 Q C 0.0000
752 Q C 0.0000
753 G C 0.0088
754 N C -0.8251
755 T C -0.2861
756 L C 0.1476
757 P C -0.0912
758 Y C 0.0000
759 T C -0.3154
760 F C 0.0000
761 G C 0.0000
762 Q C -1.7287
763 G C -1.3671
764 T C 0.0000
765 K C -1.4079
766 V C 0.0000
767 E C -1.4239
768 I C 0.0000
769 K C -1.7215
770 R C -1.1368
771 T C -0.0447
772 V C 1.0365
773 A C 0.4213
774 A C 0.0767
775 P C -0.3218
776 S C -0.2363
777 V C 0.0000
778 F C 0.1027
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C 0.0000
784 D C -3.0746
785 E C -3.1751
786 Q C 0.0000
787 L C -2.3286
788 K C -2.8869
789 S C -1.8198
790 G C -1.3782
791 T C -0.9762
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -1.1061
801 F C 0.0000
802 Y C 0.0000
803 P C -1.6566
804 R C -3.0402
805 E C -3.2056
806 A C -2.4559
807 K C -2.4659
808 V C -1.2302
809 Q C -1.2014
810 W C 0.0000
811 K C -0.5263
812 V C -0.7827
813 D C -1.5253
814 N C -1.2881
815 A C -0.3299
816 L C 0.3799
817 Q C -1.0267
818 S C -0.8412
819 G C -1.2955
820 N C -2.0267
821 S C -1.5839
822 Q C -1.2246
823 E C -1.5609
824 S C 0.0000
825 V C -0.5372
826 T C -1.0791
827 E C -2.3150
828 Q C 0.0000
829 D C -2.5412
830 S C -2.2938
831 K C -2.5531
832 D C -2.2625
833 S C -2.3368
834 T C 0.0000
835 Y C 0.0000
836 S C 0.0000
837 L C 0.0000
838 S C 0.0000
839 S C 0.0000
840 T C 0.0000
841 L C 0.0000
842 T C -0.5649
843 L C -0.7355
844 S C -1.4397
845 K C -2.3876
846 A C -2.3539
847 D C -2.8930
848 Y C 0.0000
849 E C -3.8039
850 K C -3.6958
851 H C -3.1038
852 K C -3.1071
853 V C -1.2827
854 Y C 0.0000
855 A C -0.8770
856 C C 0.0000
857 E C -1.1698
858 V C 0.0000
859 T C -1.1796
860 H C 0.0000
861 Q C -1.7650
862 G C -0.4388
863 L C -0.1510
864 S C -0.4355
865 S C -0.3419
866 P C -0.5057
867 V C 0.0176
868 T C -0.5762
869 K C -0.8568
870 S C -0.7053
871 F C 0.0000
872 N C -1.8061
873 R C -2.2746
874 G C -1.6910
875 E C -1.5110
876 C C -0.9717
877 Q D -1.1445
878 V D -0.1627
879 Q D -1.4311
880 L D 0.0000
881 Q D -1.9092
882 E D 0.0000
883 S D -0.6921
884 G D -0.3658
885 P D 0.0610
886 G D 0.1471
887 L D -0.0357
888 V D -0.9144
889 R D -2.1171
890 P D -1.3959
891 S D -1.3047
892 Q D -1.4559
893 T D -1.2407
894 L D -0.8131
895 S D -0.8769
896 L D 0.0000
897 T D -0.6974
898 C D 0.0000
899 T D -1.1217
900 V D 0.0000
901 S D -0.7634
902 G D -0.0386
903 Y D 0.9149
904 S D 0.1274
905 I D 0.0000
906 T D -0.6990
907 S D -0.9310
908 D D -2.1575
909 H D 0.0000
910 A D 0.0000
911 W D 0.0000
912 S D 0.0000
913 W D 0.0000
914 V D 0.0000
915 R D 0.0000
916 Q D -1.0613
917 P D -1.0560
918 P D -1.1525
919 G D -1.5612
920 R D -2.6920
921 G D -1.9866
922 L D 0.0000
923 E D -1.9365
924 W D 0.0000
925 I D 0.0000
926 G D 0.0000
927 Y D 0.0000
928 I D 0.0000
929 S D 0.0000
930 Y D 0.0645
931 S D 0.1996
932 G D 0.8809
933 I D 1.9810
934 T D 1.0539
935 T D 0.4304
936 Y D -0.3792
937 N D -0.8544
938 P D -1.2066
939 S D -1.0797
940 L D 0.0000
941 K D -2.3417
942 S D -1.6792
943 R D -2.2671
944 V D 0.0000
945 T D -1.1561
946 M D 0.0000
947 L D -0.1587
948 R D -0.5818
949 D D -1.2921
950 T D -1.0311
951 S D -1.3455
952 K D -2.2309
953 N D -1.4245
954 Q D -1.2687
955 F D 0.0000
956 S D 0.0000
957 L D 0.0000
958 R D -1.8772
959 L D 0.0000
960 S D -1.3283
961 S D -1.0558
962 V D 0.0000
963 T D -0.6991
964 A D -0.3919
965 A D -0.0966
966 D D -0.2744
967 T D 0.1725
968 A D 0.0000
969 V D 0.6090
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 R D -0.5959
975 S D 0.0000
976 L D -0.2507
977 A D -0.7963
978 R D -1.9020
979 T D -0.9865
980 T D -0.7590
981 A D 0.0312
982 M D 0.0000
983 D D -0.1745
984 Y D -0.2282
985 W D 0.0000
986 G D 0.0000
987 Q D -2.0721
988 G D -0.7903
989 S D 0.1429
990 L D 1.3320
991 V D 0.0000
992 T D 0.0797
993 V D 0.0000
994 S D -0.7567
995 S D -0.9340
996 A D -0.7136
997 S D -0.8789
998 T D -0.9221
999 K D -1.6110
1000 G D -1.5056
1001 P D -0.7802
1002 S D -0.4230
1003 V D 0.0000
1004 F D -0.8519
1005 P D -1.4387
1006 L D 0.0000
1007 A D 0.0000
1008 P D 0.0000
1009 S D 0.0000
1010 S D -1.1142
1011 K D -1.8426
1012 S D -1.1849
1013 T D -0.9417
1014 S D -0.8711
1015 G D -0.7740
1016 G D -0.7059
1017 T D -0.5295
1018 A D 0.0000
1019 A D 0.0000
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D -0.4044
1026 D D -0.8067
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.4622
1031 P D -0.6194
1032 V D -0.7958
1033 T D -0.5437
1034 V D -0.2907
1035 S D -0.2672
1036 W D 0.0000
1037 N D -0.8283
1038 S D -0.6106
1039 G D -0.3472
1040 A D -0.1911
1041 L D 0.0171
1042 T D -0.0875
1043 S D -0.0887
1044 G D 0.0008
1045 V D 0.3797
1046 H D -0.1386
1047 T D 0.0999
1048 F D 0.0000
1049 P D -0.1455
1050 A D 0.2650
1051 V D 0.6670
1052 L D 1.0891
1053 Q D -0.5677
1054 S D -0.4129
1055 S D -0.4392
1056 G D 0.0000
1057 L D -0.1475
1058 Y D 0.0000
1059 S D 0.0000
1060 L D 0.1092
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.0516
1066 V D 0.0000
1067 P D -0.5974
1068 S D -0.6376
1069 S D -0.7148
1070 S D -0.8556
1071 L D 0.0000
1072 G D -1.2752
1073 T D -0.9676
1074 Q D -1.3956
1075 T D -1.3847
1076 Y D 0.0000
1077 I D -1.5674
1078 C D 0.0000
1079 N D 0.0000
1080 V D 0.0000
1081 N D -2.0170
1082 H D 0.0000
1083 K D -2.7161
1084 P D -1.6899
1085 S D -1.9158
1086 N D -2.5455
1087 T D -2.1662
1088 K D -2.6506
1089 V D -1.7415
1090 D D -2.7593
1091 K D -2.5139
1092 K D -2.9445
1093 V D 0.0000
1094 E D -2.6898
1095 P D -1.6273
1096 K D -1.2912
1097 S D -1.5081
1098 C D -1.2506
1099 D D -2.0312
1100 K D -2.4327
1101 T D -1.6585
1102 H D -1.9083
1103 T D -1.5060
1104 C D -1.2201
1105 P D -1.2729
1106 P D -0.8441
1107 C D -0.3912
1108 P D -0.5984
1109 A D -0.8340
1110 P D -1.1236
1111 E D -1.2425
1112 L D 0.2845
1113 L D 1.4243
1114 G D 0.0393
1115 G D -0.1501
1116 P D 0.1111
1117 S D 0.4217
1118 V D 1.0831
1119 F D 2.3451
1120 L D 1.7073
1121 F D 2.1877
1122 P D 0.6055
1123 P D 0.0000
1124 K D -1.8486
1125 P D -1.2597
1126 K D -0.9721
1127 D D -1.2044
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.5785
1131 I D 1.4322
1132 S D -0.0528
1133 R D -1.2624
1134 T D -0.6087
1135 P D 0.0000
1136 E D -0.6327
1137 V D 0.0000
1138 T D 1.1346
1139 C D 0.0000
1140 V D 0.9298
1141 V D 0.0000
1142 V D 0.4883
1143 D D -0.0260
1144 V D 0.0000
1145 S D -1.6037
1146 H D -2.2588
1147 E D -2.8008
1148 D D 0.0000
1149 P D -2.4613
1150 E D -3.1336
1151 V D 0.0000
1152 K D -2.4836
1153 F D 0.0000
1154 N D -1.3918
1155 W D 0.0000
1156 Y D -0.9825
1157 V D -0.7104
1158 D D -1.9873
1159 G D -0.6790
1160 V D 0.8723
1161 E D -0.2889
1162 V D 0.5102
1163 H D -1.0984
1164 N D -1.0788
1165 A D -1.0488
1166 K D -2.0954
1167 T D -1.5425
1168 K D -2.3884
1169 P D -2.2582
1170 R D -3.2883
1171 E D -2.8497
1172 E D -2.7342
1173 Q D -1.8204
1174 Y D -0.7416
1175 N D -0.7641
1176 S D -0.7204
1177 T D 0.0000
1178 Y D 0.0000
1179 R D -1.5406
1180 V D 0.0000
1181 V D -0.7933
1182 S D 0.0000
1183 V D 0.1851
1184 L D 0.0000
1185 T D -0.1894
1186 V D 0.4904
1187 L D 0.9885
1188 H D -0.0942
1189 Q D -1.0455
1190 D D -1.0493
1191 W D 0.0000
1192 L D -1.1211
1193 N D -1.9808
1194 G D -2.0419
1195 K D -2.0314
1196 E D -2.1786
1197 Y D 0.0000
1198 K D -1.8273
1199 C D 0.0000
1200 K D -1.5749
1201 V D 0.0000
1202 S D -1.3618
1203 N D -1.8166
1204 K D -2.0660
1205 A D -1.2507
1206 L D -0.5534
1207 P D -0.4678
1208 A D -0.2513
1209 P D -0.3355
1210 I D -0.2544
1211 E D -1.3147
1212 K D -1.5320
1213 T D -1.1604
1214 I D 0.0193
1215 S D -1.5300
1216 K D -1.4713
1217 A D -1.3436
1218 K D -2.3468
1219 G D -2.1415
1220 Q D -2.4107
1221 P D -2.3703
1222 R D -3.0622
1223 E D -3.0205
1224 P D 0.0000
1225 Q D -1.4126
1226 V D 0.0000
1227 Y D 0.0000
1228 T D -0.6257
1229 L D -0.1180
1230 P D -0.3282
1231 P D -0.4403
1232 S D -0.8426
1233 R D -1.7622
1234 D D -1.3767
1235 E D 0.0000
1236 L D -0.0051
1237 T D -0.7283
1238 K D -1.8198
1239 N D -2.2814
1240 Q D -2.1110
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.0000
1247 V D 0.0000
1248 K D -0.6514
1249 G D -1.2213
1250 F D 0.0000
1251 Y D -1.4523
1252 P D 0.0000
1253 S D -0.2139
1254 D D -0.9679
1255 I D 0.0000
1256 A D -0.5374
1257 V D -0.3139
1258 E D -1.1057
1259 W D 0.0000
1260 E D -1.9010
1261 S D 0.0000
1262 N D -2.2757
1263 G D -1.9022
1264 Q D -2.2564
1265 P D -2.0614
1266 E D -2.4081
1267 N D -2.2581
1268 N D -1.8837
1269 Y D -1.1798
1270 K D -0.7712
1271 T D -0.4218
1272 T D 0.0000
1273 P D 0.0073
1274 P D 0.2912
1275 V D 0.8153
1276 L D 1.0369
1277 D D -0.3889
1278 S D -1.3047
1279 D D -2.0153
1280 G D -0.9555
1281 S D -0.8188
1282 F D 0.1416
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D -0.9277
1290 V D 0.0000
1291 D D -2.4247
1292 K D -2.3058
1293 S D -2.4021
1294 R D -3.0992
1295 W D 0.0000
1296 Q D -2.7853
1297 Q D -2.7930
1298 G D -1.6850
1299 N D -1.8130
1300 V D -0.6823
1301 F D 0.0000
1302 S D -1.0276
1303 C D 0.0000
1304 S D -0.6539
1305 V D 0.0000
1306 M D 0.0000
1307 H D 0.0000
1308 E D -1.2538
1309 A D -1.9906
1310 L D 0.0000
1311 H D -1.8312
1312 N D -1.7560
1313 H D -1.2031
1314 Y D -0.6967
1315 T D -0.9764
1316 Q D -1.0168
1317 K D -1.0664
1318 S D -0.3814
1319 L D 0.0000
1320 S D 0.1548
1321 L D 1.2441
1322 S D 0.2258
1323 P D -0.5866
1324 G D -0.8809

 

Laboratory of Theory of Biopolymers 2015