Project name: 1258 [mutate: SA36R] [mutate: VA23K]

Status: done

submitted: 2018-01-12 15:50:17, status changed: 2018-01-12 16:00:12
Settings
Chain sequence(s) A: KELVLALYDYQEKSPREVTMKKGDILTLLNRTNKDWWKVEVNDRQGFVPAAYVKKLD
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues VA23K
Energy difference between WT (input) and mutated protein (by FoldX) 2.01602 kcal/mol
Show buried residues

Minimal score value
-3.4064
Maximal score value
0.8961
Average score
-1.3517
Total score value
-77.0467

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 K A -2.0931
7 E A -1.9081
8 L A -0.3568
9 V A 0.0000
10 L A 0.1434
11 A A 0.0000
12 L A -0.2699
13 Y A -0.7411
14 D A -2.6089
15 Y A 0.0000
16 Q A -2.5839
17 E A -2.6853
18 K A -2.7229
19 S A -1.7851
20 P A -1.3849
21 R A -1.8785
22 E A 0.0000
23 K A -1.9440 mutated: VA23K
24 T A -2.0546
25 M A 0.0000
26 K A -3.0405
27 K A -2.5317
28 G A -1.3531
29 D A -0.9822
30 I A 0.8961
31 L A 0.0000
32 T A -0.7214
33 L A 0.0000
34 L A -1.0335
35 N A -1.6456
36 R A -2.5927
37 T A -2.1523
38 N A -3.2077
39 K A -3.4064
40 D A -2.9857
41 W A -1.7625
42 W A -1.5072
43 K A -1.4371
44 V A 0.0000
45 E A -1.8991
46 V A 0.0000
47 N A -2.5740
48 D A -3.2932
49 R A -3.0106
50 Q A -2.6113
51 G A 0.0000
52 F A -1.0104
53 V A 0.0000
54 P A -0.6284
55 A A -1.4856
56 A A -0.3182
57 Y A 0.1291
58 V A 0.0000
59 K A -1.3308
60 K A -1.6678
61 L A -0.8045
62 D A -2.2047

 

Laboratory of Theory of Biopolymers 2015