Project name: 1mut

Status: done

submitted: 2017-03-15 21:53:41, status changed: 2017-03-15 22:00:26
Settings
Chain sequence(s) A: TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITDMFEETQVPALLEAGFRRENIRTEVMANSPPADCRYYAFPQMITPLVTKG
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.117
Maximal score value
0.7235
Average score
-0.3541
Total score value
-81.4526

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 T A -0.1166
8 P A -0.2191
9 I A 0.2251
10 F A 0.0000
11 A A -0.0103
12 P A -0.3335
13 G A -0.5823
14 E A -0.6997
15 N A -1.3458
16 C A 0.0000
17 S A -0.1121
18 P A -0.2610
19 A A -0.0141
20 W A 0.0000
21 G A -0.1130
22 A A 0.0362
23 A A 0.0000
24 P A -0.2527
25 A A -0.0273
26 A A 0.0872
27 Y A 0.1688
28 D A -0.4820
29 A A -0.0279
30 A A -0.0773
31 D A -0.8170
32 T A -0.3165
33 H A -0.3780
34 L A 0.0000
35 R A -1.2411
36 I A 0.0000
37 L A 0.7235
38 G A -0.3219
39 K A 0.0000
40 P A 0.0000
41 V A 0.2703
42 M A 0.0000
43 E A -0.3831
44 R A -0.7763
45 W A 0.0624
46 E A 0.0000
47 T A -0.0348
48 P A -0.1080
49 Y A 0.0000
50 M A 0.0000
51 H A -0.3964
52 A A -0.0620
53 L A 0.0000
54 A A 0.0000
55 A A 0.0463
56 A A 0.0000
57 A A 0.0000
58 S A 0.0000
59 S A -0.4882
60 K A -1.6034
61 G A -0.3614
62 G A -0.4539
63 R A -0.5720
64 V A 0.0000
65 L A 0.0000
66 E A 0.0000
67 V A 0.0000
68 G A -0.0765
69 F A 0.0000
70 G A -0.0592
71 M A 0.0914
72 A A 0.0258
73 I A 0.0000
74 A A 0.0000
75 A A 0.0000
76 S A -0.2293
77 K A -0.6786
78 V A 0.0000
79 Q A 0.0000
80 E A -1.8180
81 A A -0.3595
82 P A -0.2530
83 I A 0.0000
84 D A -1.8582
85 E A -0.6721
86 H A 0.0000
87 W A 0.1767
88 I A 0.0000
89 I A 0.0000
90 E A 0.0000
91 C A 0.1402
92 N A 0.0000
93 D A -1.7871
94 G A -0.4429
95 V A 0.0000
96 F A -0.1706
97 Q A -1.5060
98 R A -1.3143
99 L A 0.0000
100 R A -1.9310
101 D A -1.9510
102 W A -0.1824
103 A A -0.0158
104 P A -0.5868
105 R A -1.9312
106 Q A -0.5734
107 T A -0.1432
108 H A -0.4921
109 K A -1.6953
110 V A -0.0704
111 I A 0.2974
112 P A 0.0438
113 L A -0.0285
114 K A -1.6596
115 G A -0.2994
116 L A 0.3932
117 W A -0.1310
118 E A -2.1170
119 D A -2.1140
120 V A 0.0000
121 A A 0.0000
122 P A -0.2675
123 T A -0.1162
124 L A 0.0000
125 P A -0.4348
126 D A -1.8614
127 G A -0.7373
128 H A -0.2516
129 F A 0.0000
130 D A -0.1996
131 G A 0.0000
132 I A 0.0000
133 L A 0.0000
134 Y A 0.0000
135 D A -0.4023
136 T A -0.1005
137 Y A 0.0000
138 P A 0.0000
139 L A 0.2309
140 S A -0.2989
141 E A -1.0932
142 E A -1.9599
143 T A -0.3269
144 W A 0.0548
145 H A -0.3476
146 T A -0.0964
147 H A 0.0000
148 Q A 0.0000
149 F A 0.0370
150 N A -0.8936
151 F A 0.0000
152 I A 0.0000
153 K A -1.3992
154 N A -1.4857
155 H A 0.0000
156 A A 0.0000
157 F A 0.4682
158 R A -0.3887
159 L A 0.0000
160 L A 0.0000
161 K A -0.6982
162 P A -0.3918
163 G A -0.2036
164 G A 0.0000
165 V A 0.0000
166 L A 0.0000
167 T A 0.0000
168 Y A 0.0000
169 C A 0.0000
170 N A 0.0000
171 L A 0.0000
172 T A 0.0000
173 S A 0.0000
174 W A 0.0000
175 G A 0.0000
176 E A -1.4476
177 L A -0.1062
178 M A 0.0000
179 K A -1.7387
180 S A -0.8284
181 K A -1.7143
182 Y A -0.2095
183 S A -0.4344
184 D A -1.4100
185 I A 0.0000
186 T A -0.3162
187 D A -1.6592
188 M A 0.0000
189 F A 0.0000
190 E A -1.4563
191 E A -1.9990
192 T A -0.3430
193 Q A 0.0000
194 V A 0.0000
195 P A -0.1873
196 A A -0.2150
197 L A 0.0000
198 L A 0.0716
199 E A -1.7471
200 A A -0.5129
201 G A -0.1368
202 F A 0.0000
203 R A -1.7169
204 R A -1.4221
205 E A -2.0210
206 N A -0.6424
207 I A 0.0000
208 R A -1.3470
209 T A -0.5743
210 E A -1.4584
211 V A 0.5596
212 M A 0.3395
213 A A 0.0108
214 N A -0.2053
215 S A -0.2839
216 P A -0.0909
217 P A -0.1434
218 A A -0.2888
219 D A -1.7651
220 C A -0.5763
221 R A -1.8301
222 Y A 0.0000
223 Y A 0.0000
224 A A 0.0926
225 F A 0.2260
226 P A -0.3015
227 Q A -0.4449
228 M A 0.0000
229 I A 0.0000
230 T A 0.0000
231 P A 0.0000
232 L A 0.2137
233 V A 0.0000
234 T A -0.0513
235 K A -0.3204
236 G A -0.5087

 

Laboratory of Theory of Biopolymers 2015