Project name: 3a613ff0126ca99

Status: done

submitted: 2017-11-14 10:16:16, status changed: 2017-11-14 11:42:16
Settings
Chain sequence(s) A: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLISPVQYLRWGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
C: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLISPVQYLRWGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9931
Maximal score value
2.3314
Average score
-0.6589
Total score value
-878.9411

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -0.8861
2 A A 0.0080
3 V A 0.0000
4 L A 1.0496
5 T A -0.1683
6 Q A -1.1028
7 P A -0.9102
8 P A -0.9559
9 S A -0.9412
10 V A -0.3317
11 S A -0.2905
12 G A 0.0000
13 A A -1.1779
14 P A -1.6297
15 G A -1.8411
16 Q A -2.4433
17 R A -2.5732
18 V A 0.0000
19 T A -0.7515
20 I A 0.0000
21 S A -0.3768
22 C A 0.0000
23 T A 0.0049
24 G A 0.0000
25 S A -0.4085
26 S A -0.4681
27 S A -0.0780
28 N A 0.0000
29 I A 1.8561
30 G A 0.0000
31 A A 0.6695
32 G A 0.5640
33 Y A 0.8847
34 G A 0.0000
35 V A 0.0000
36 H A 0.0000
37 W A 0.0000
38 Y A 0.0000
39 Q A 0.0000
40 Q A -1.3040
41 L A -1.1258
42 P A -0.9620
43 G A -0.7930
44 T A -1.3558
45 A A -1.7142
46 P A 0.0000
47 K A 0.0000
48 L A 0.0000
49 L A 0.0000
50 I A 0.0000
51 S A 0.2057
52 P A 0.6480
53 V A 0.5629
54 Q A -0.0482
55 Y A 1.1573
56 L A 0.4422
57 R A -0.0576
58 W A 0.7962
59 G A -0.1652
60 V A -0.1290
61 P A -1.0744
62 D A -1.8446
63 R A -1.3463
64 F A 0.0000
65 S A -0.3818
66 G A 0.0000
67 S A -0.3193
68 K A -0.2304
69 S A 0.1543
70 G A 0.2339
71 T A -0.1606
72 S A -0.0862
73 A A 0.0000
74 S A -0.4708
75 L A 0.0000
76 A A -0.5151
77 I A 0.0000
78 T A -1.7088
79 G A -1.7551
80 L A 0.0000
81 Q A -2.2716
82 A A -1.9646
83 E A -2.3918
84 D A 0.0000
85 E A -1.6202
86 A A 0.0000
87 D A -1.4240
88 Y A 0.0000
89 Y A 0.0000
90 C A 0.0000
91 Q A 0.0000
92 S A 0.0000
93 Y A 0.0000
94 D A -0.3690
95 N A -1.0034
96 S A 0.1725
97 L A 0.6805
98 S A -0.0562
99 G A 0.0000
100 Y A 0.0000
101 V A -0.0745
102 F A 0.0000
103 G A 0.0000
104 G A -0.8051
105 G A -1.0609
106 T A 0.0000
107 Q A -1.4379
108 L A 0.0000
109 T A 0.0000
110 V A 0.0000
111 L A -0.2931
112 G A -0.7700
113 Q A -1.4313
114 P A -1.4352
115 K A -2.3380
116 A A -1.4291
117 A A -0.9266
118 P A 0.0000
119 S A -0.2318
120 V A 0.1609
121 T A 0.1803
122 L A 0.0000
123 F A 0.0000
124 P A -0.1685
125 P A 0.0000
126 S A -0.9463
127 S A -1.4449
128 E A -2.3415
129 E A 0.0000
130 L A -1.9116
131 Q A -2.4176
132 A A -1.7208
133 N A -2.5618
134 K A -2.1685
135 A A 0.0000
136 T A 0.0000
137 L A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 I A 0.0000
142 S A 0.0000
143 D A -0.8444
144 F A 0.0000
145 Y A -1.1067
146 P A -0.9151
147 G A -0.2886
148 A A -0.2247
149 V A -0.1041
150 T A -0.2135
151 V A 0.4145
152 A A 0.2243
153 W A 0.0000
154 K A -0.3975
155 A A 0.0000
156 D A -1.0834
157 S A -0.6961
158 S A -0.4380
159 P A -0.1788
160 V A 0.4512
161 K A -0.9666
162 A A -0.4621
163 G A -0.3772
164 V A 0.1589
165 E A 0.0113
166 T A -0.0269
167 T A -0.1061
168 T A -0.3576
169 P A -0.7809
170 S A -1.1284
171 K A -2.0601
172 Q A -2.4459
173 S A -1.3610
174 N A -1.5089
175 N A -1.5659
176 K A -1.4379
177 Y A -0.5300
178 A A 0.0000
179 A A -0.1430
180 S A 0.0000
181 S A 0.0000
182 Y A 0.0000
183 L A 0.0000
184 S A -0.2279
185 L A -0.9619
186 T A -1.6064
187 P A -2.3861
188 E A -3.0981
189 Q A -2.3070
190 W A -2.1244
191 K A -2.7255
192 S A -2.1907
193 H A -2.2361
194 R A -2.4524
195 S A -1.3154
196 Y A 0.0000
197 S A -0.2624
198 C A 0.0000
199 Q A -0.3490
200 V A 0.0000
201 T A -0.7751
202 H A 0.0000
203 E A -2.2290
204 G A -1.6441
205 S A -0.6768
206 T A -0.2090
207 V A 0.5514
208 E A -1.2316
209 K A -0.5759
210 T A -0.1678
211 V A 0.4029
212 A A 0.1045
213 P A -0.5933
214 T A -0.9798
215 E A -1.3012
216 C A -0.5149
217 S A -0.6655
218 Q B -1.2181
219 V B -0.8448
220 Q B -1.4824
221 L B 0.0000
222 V B 0.3501
223 Q B 0.0000
224 S B -0.7715
225 G B -0.9833
226 A B 0.0000
227 E B -1.4587
228 V B -0.9126
229 K B -1.5844
230 K B -2.0664
231 P B -1.8387
232 G B -1.6527
233 A B -1.3107
234 S B -1.5436
235 V B -1.5019
236 K B -1.9085
237 V B 0.0000
238 S B -0.8914
239 C B 0.0000
240 K B -1.0029
241 A B 0.0000
242 S B -0.4520
243 G B -0.7372
244 Y B -0.2990
245 T B -0.2687
246 F B 0.0000
247 T B -0.1473
248 N B -0.7517
249 Y B 0.1009
250 Y B 0.5371
251 M B 0.0000
252 H B 0.0000
253 W B 0.0000
254 V B 0.0000
255 R B 0.0000
256 Q B -0.8951
257 A B -1.0822
258 P B -0.9615
259 G B -1.2407
260 Q B -1.9150
261 G B -1.4513
262 L B -1.0369
263 E B -1.5863
264 W B 0.0000
265 V B 0.0000
266 G B 0.0000
267 W B 0.9315
268 I B 0.0000
269 N B 0.0000
270 P B 0.0000
271 Y B 0.9843
272 T B 0.2861
273 G B 0.0410
274 S B 0.3908
275 A B 1.0070
276 F B 1.9435
277 Y B 0.4096
278 A B -0.8267
279 Q B -2.5212
280 K B -2.6963
281 F B 0.0000
282 R B -2.8662
283 G B -2.4625
284 R B -3.2096
285 V B 0.0000
286 T B -1.1959
287 M B 0.0000
288 T B -0.3638
289 R B -0.0912
290 D B -0.3475
291 T B 0.1741
292 S B 0.4730
293 I B 1.4000
294 S B 0.2203
295 T B 0.0000
296 A B 0.0000
297 Y B -0.7899
298 M B 0.0000
299 E B -1.9375
300 L B 0.0000
301 S B -2.0470
302 R B -2.6060
303 L B 0.0000
304 R B -2.1765
305 S B -1.8951
306 D B -2.1930
307 D B 0.0000
308 T B -0.7250
309 A B 0.0000
310 V B 0.0000
311 Y B 0.0000
312 Y B 0.0000
313 C B 0.0000
314 A B 0.0000
315 R B -0.0632
316 E B -0.0195
317 P B -0.0582
318 E B -0.1130
319 K B 0.0000
320 F B 0.0000
321 D B 0.0000
322 S B 0.0000
323 D B -2.6543
324 D B -2.9692
325 S B 0.0000
326 D B 0.0000
327 V B 0.0000
328 W B 0.0000
329 G B 0.0000
330 R B -1.6082
331 G B 0.0000
332 T B 0.0000
333 L B 0.4344
334 V B 0.0000
335 T B -0.7480
336 V B 0.0000
337 S B -1.1294
338 S B -0.9989
339 A B -0.7781
340 S B -0.8938
341 T B -1.0060
342 K B -1.7141
343 G B -1.6002
344 P B -0.7441
345 S B -0.6257
346 V B 0.0000
347 F B 0.0000
348 P B -1.2688
349 L B 0.0000
350 A B 0.0000
351 P B -0.8867
352 S B -0.9284
353 S B -1.2991
354 K B -1.7847
355 S B -1.1475
356 T B -0.9485
357 S B -0.8850
358 G B -0.7735
359 G B -0.7008
360 T B -0.5354
361 A B -0.3696
362 A B -0.0465
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.4366
369 D B -0.6525
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -1.0044
374 P B -0.8036
375 V B -0.5412
376 T B -0.5485
377 V B -0.1296
378 S B -0.2834
379 W B 0.0000
380 N B -0.7220
381 S B -0.5959
382 G B -0.3247
383 A B -0.0922
384 L B 0.1967
385 T B -0.0239
386 S B -0.0722
387 G B -0.0469
388 V B 0.3161
389 H B -0.1403
390 T B 0.0023
391 F B 0.0000
392 P B 0.0650
393 A B 0.3001
394 V B 0.8652
395 L B 1.3776
396 Q B 0.2332
397 S B -0.0801
398 S B -0.3522
399 G B -0.0455
400 L B 0.0389
401 Y B 0.2685
402 S B 0.0000
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0629
409 V B 0.0000
410 P B -0.5937
411 S B -0.6276
412 S B -0.7084
413 S B -0.8523
414 L B 0.0000
415 G B -1.2591
416 T B -0.9682
417 Q B -1.4348
418 T B -1.3715
419 Y B 0.0000
420 I B -1.4214
421 C B 0.0000
422 N B -1.5644
423 V B 0.0000
424 N B -1.8985
425 H B 0.0000
426 K B -2.6991
427 P B -1.8733
428 S B -1.8891
429 N B -2.4783
430 T B -2.0986
431 K B -2.6376
432 V B -1.8498
433 D B -2.7228
434 K B -2.4415
435 K B -2.8471
436 V B 0.0000
437 E B -2.8503
438 P B -2.0494
439 K B -1.9510
440 S B -1.0770
441 C B -0.5532
442 D B -0.6171
443 K B -0.5712
444 T B 0.0000
445 H B -0.9486
446 T B -0.8694
447 C B -0.7619
448 P B -0.4006
449 P B -0.2576
450 C B -0.0984
451 P B -0.2683
452 A B -0.4592
453 P B -0.6702
454 E B -1.3606
455 L B 0.1046
456 L B 0.8168
457 G B -0.0412
458 G B -0.1805
459 P B 0.0000
460 S B 0.3213
461 V B 0.0000
462 F B 2.3314
463 L B 1.7572
464 F B 2.1777
465 P B 0.3664
466 P B 0.0000
467 K B -1.9652
468 P B -1.3630
469 K B -1.2759
470 D B -1.3776
471 T B 0.0000
472 L B 0.0000
473 M B 0.4348
474 I B 1.5243
475 S B -0.0808
476 R B -1.3635
477 T B -0.5281
478 P B 0.0000
479 E B -0.8704
480 V B 0.0000
481 T B 1.0846
482 C B 0.0000
483 V B 0.9322
484 V B 0.0000
485 V B 0.1093
486 D B -0.8622
487 V B 0.0000
488 S B -1.8683
489 H B -2.2979
490 E B -2.7973
491 D B -2.3497
492 P B -2.2753
493 E B -2.5363
494 V B 0.0000
495 K B -2.4262
496 F B -1.9372
497 N B -1.4835
498 W B 0.0000
499 Y B -1.0825
500 V B -0.8767
501 D B -2.0445
502 G B -0.7183
503 V B 0.8606
504 E B -0.3139
505 V B 0.0774
506 H B -1.3016
507 N B -1.2724
508 A B -1.2196
509 K B -2.2739
510 T B -1.7090
511 K B -2.7615
512 P B -2.2287
513 R B -3.2440
514 E B -3.9931
515 E B -3.6247
516 Q B -2.7736
517 Y B -1.4413
518 N B -1.4490
519 S B -1.1059
520 T B -1.5997
521 Y B -2.4269
522 R B -2.1485
523 V B 0.0000
524 V B -0.9644
525 S B 0.0000
526 V B -0.0690
527 L B 0.0000
528 T B -0.2944
529 V B 0.5363
530 L B 1.2163
531 H B 0.0000
532 Q B -0.8253
533 D B -0.8535
534 W B 0.0000
535 L B -0.7559
536 N B -1.9046
537 G B -2.0487
538 K B -2.1718
539 E B -2.4676
540 Y B 0.0000
541 K B -1.9811
542 C B 0.0000
543 K B -1.8007
544 V B 0.0000
545 S B -1.3821
546 N B -1.7465
547 K B -2.0955
548 A B -1.2589
549 L B -0.5687
550 P B -0.4220
551 A B -0.3190
552 P B -0.4413
553 I B -0.4569
554 E B -1.4462
555 K B -1.6477
556 T B -1.2286
557 I B 0.0616
558 S B -1.5863
559 K B -1.4181
560 A B -1.2932
561 K B -2.3463
562 G B -2.1256
563 Q B -2.2016
564 P B -2.3067
565 R B -2.9883
566 E B -2.8800
567 P B 0.0000
568 Q B -1.5089
569 V B 0.0000
570 Y B 0.0000
571 T B 0.0000
572 L B 0.0000
573 P B -0.3156
574 P B -0.6832
575 S B -1.3007
576 R B -2.4480
577 E B -2.6359
578 E B 0.0000
579 M B -0.7940
580 T B -1.1783
581 K B -2.2498
582 N B -2.5561
583 Q B -2.3013
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B -0.7123
592 G B -1.2427
593 F B 0.0000
594 Y B -1.4223
595 P B 0.0000
596 S B 0.0014
597 D B -0.8862
598 I B 0.0000
599 A B -0.5157
600 V B -0.4314
601 E B -1.1679
602 W B 0.0000
603 E B -1.7797
604 S B 0.0000
605 N B -2.0779
606 G B -1.8572
607 Q B -2.1752
608 P B -1.9272
609 E B -2.1219
610 N B -2.1019
611 N B -1.7889
612 Y B -1.0828
613 K B -0.7664
614 T B -0.3944
615 T B 0.0000
616 P B 0.0280
617 P B 0.2497
618 V B 0.6517
619 L B 0.7178
620 D B -0.5223
621 S B -1.3663
622 D B -2.0093
623 G B -0.9307
624 S B -0.8327
625 F B 0.0564
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9778
633 V B 0.0000
634 D B -2.6006
635 K B -2.2125
636 S B -1.9589
637 R B -2.0140
638 W B -1.6877
639 Q B -2.3027
640 Q B -2.2910
641 G B -1.5191
642 N B -1.3919
643 V B -0.7540
644 F B 0.0000
645 S B -1.0957
646 C B 0.0000
647 S B 0.0000
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.2193
652 A B -1.9144
653 L B 0.0000
654 H B -1.8381
655 N B -1.7437
656 H B -1.2700
657 Y B -0.8142
658 T B -1.1880
659 Q B -1.3524
660 K B -0.9865
661 S B -0.5411
662 L B 0.0000
663 S B -0.4934
664 L B 0.0000
665 S B -0.8692
666 P B -0.7306
667 G B -0.9691
668 Q C -1.1373
669 A C -0.2160
670 V C 0.0000
671 L C 1.1289
672 T C -0.0403
673 Q C -0.8511
674 P C -0.7772
675 P C -0.7964
676 S C -0.7742
677 V C -0.2910
678 S C -0.3997
679 G C 0.0000
680 A C -0.9764
681 P C -1.2408
682 G C -1.6454
683 Q C -2.3940
684 R C -2.6155
685 V C 0.0000
686 T C -0.7227
687 I C 0.0000
688 S C -0.3086
689 C C 0.0000
690 T C 0.0604
691 G C 0.0000
692 S C -0.4576
693 S C -0.5624
694 S C -0.1357
695 N C 0.0000
696 I C 1.7121
697 G C 0.7637
698 A C 0.3286
699 G C 0.0000
700 Y C 0.0000
701 G C 0.0000
702 V C 0.0000
703 H C 0.0000
704 W C 0.0000
705 Y C 0.0000
706 Q C -0.5363
707 Q C -0.6335
708 L C -0.3306
709 P C -0.5800
710 G C -0.6787
711 T C -0.9607
712 A C 0.0000
713 P C 0.0000
714 K C -1.2492
715 L C 0.0000
716 L C 0.0000
717 I C 0.0000
718 S C 0.0000
719 P C 0.5077
720 V C 0.8600
721 Q C 0.2154
722 Y C 1.2671
723 L C 0.4509
724 R C -0.1919
725 W C 0.7376
726 G C -0.2195
727 V C -0.2421
728 P C -1.1842
729 D C -1.9681
730 R C -1.5557
731 F C 0.0000
732 S C -0.3560
733 G C 0.0000
734 S C -0.2261
735 K C -0.1687
736 S C 0.2143
737 G C 0.2821
738 T C -0.1557
739 S C -0.1054
740 A C 0.0000
741 S C -0.4044
742 L C 0.0000
743 A C -0.5312
744 I C 0.0000
745 T C -1.7163
746 G C -1.6181
747 L C 0.0000
748 Q C -1.5725
749 A C -1.5817
750 E C -2.1509
751 D C 0.0000
752 E C -1.2738
753 A C 0.0000
754 D C -0.6832
755 Y C 0.0000
756 Y C 0.0000
757 C C 0.0000
758 Q C 0.0000
759 S C 0.0000
760 Y C -0.2318
761 D C -0.8274
762 N C -1.1978
763 S C 0.1520
764 L C 0.7304
765 S C 0.1543
766 G C 0.0000
767 Y C 0.0000
768 V C 0.3145
769 F C 0.0000
770 G C 0.0000
771 G C -0.5008
772 G C -0.7649
773 T C 0.0000
774 Q C -1.1276
775 L C 0.0000
776 T C -0.3542
777 V C 0.0000
778 L C -0.7897
779 G C -0.7804
780 Q C -1.3347
781 P C -1.3937
782 K C -2.3666
783 A C -1.4476
784 A C -1.0247
785 P C 0.0000
786 S C -0.3948
787 V C -0.0498
788 T C 0.1307
789 L C 0.0000
790 F C 0.0000
791 P C 0.0000
792 P C 0.0000
793 S C 0.0000
794 S C -1.2421
795 E C -2.0664
796 E C 0.0000
797 L C -2.1258
798 Q C -2.1917
799 A C -1.7283
800 N C -2.6789
801 K C -2.5266
802 A C 0.0000
803 T C 0.0000
804 L C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 I C 0.0000
809 S C -0.3713
810 D C -1.1105
811 F C 0.0000
812 Y C -1.2240
813 P C -1.0184
814 G C -0.4018
815 A C -0.2641
816 V C -0.1083
817 T C -0.1963
818 V C 0.4643
819 A C 0.3048
820 W C 0.0000
821 K C -0.3747
822 A C 0.0000
823 D C -1.1164
824 S C -0.7108
825 S C -0.4067
826 P C -0.0573
827 V C 0.7615
828 K C -0.8556
829 A C -0.3458
830 G C -0.1893
831 V C 0.2055
832 E C -0.0090
833 T C -0.0038
834 T C -0.0725
835 T C -0.3328
836 P C -0.7122
837 S C -1.1255
838 K C -2.0535
839 Q C -2.4085
840 S C -1.5181
841 N C -1.9070
842 N C 0.0000
843 K C -1.5361
844 Y C -0.6396
845 A C 0.0000
846 A C -0.1719
847 S C 0.0000
848 S C 0.0000
849 Y C 0.1098
850 L C 0.0000
851 S C -0.4079
852 L C -1.0641
853 T C -1.8927
854 P C 0.0000
855 E C -3.4984
856 Q C -2.7541
857 W C 0.0000
858 K C -3.3944
859 S C -2.5133
860 H C -2.5927
861 R C -2.5418
862 S C -1.2957
863 Y C 0.0000
864 S C -0.2728
865 C C 0.0000
866 Q C -0.4951
867 V C 0.0000
868 T C -0.9380
869 H C 0.0000
870 E C -2.2730
871 G C -1.6934
872 S C -0.8086
873 T C -0.2999
874 V C 0.3878
875 E C -1.5577
876 K C -1.0682
877 T C -0.4257
878 V C 0.2781
879 A C 0.0954
880 P C 0.0000
881 T C -0.7598
882 E C -0.9308
883 C C -0.1461
884 S C -0.6539
885 Q D -1.0137
886 V D -0.3371
887 Q D -1.4931
888 L D 0.0000
889 V D -1.1438
890 Q D 0.0000
891 S D -1.1397
892 G D -1.0142
893 A D 0.0000
894 E D -1.3387
895 V D -0.8045
896 K D -1.4568
897 K D -2.2384
898 P D -2.3069
899 G D -2.1872
900 A D -1.5563
901 S D -1.5035
902 V D -1.4459
903 K D -1.8590
904 V D 0.0000
905 S D -1.0541
906 C D 0.0000
907 K D -1.5426
908 A D 0.0000
909 S D -0.6239
910 G D -0.5592
911 Y D -0.1248
912 T D -0.2012
913 F D 0.0000
914 T D -0.0825
915 N D -0.7126
916 Y D 0.1353
917 Y D 0.3723
918 M D 0.0000
919 H D 0.0000
920 W D 0.0000
921 V D 0.0000
922 R D 0.0000
923 Q D -0.5518
924 A D -0.8131
925 P D -0.7730
926 G D -1.0390
927 Q D -1.3743
928 G D -0.9091
929 L D 0.0000
930 E D -0.6203
931 W D 0.0000
932 V D 0.0000
933 G D 0.0000
934 W D 0.7416
935 I D 0.0000
936 N D 0.4184
937 P D 0.0000
938 Y D 0.9769
939 T D 0.3524
940 G D 0.0260
941 S D 0.3340
942 A D 0.7512
943 F D 1.5349
944 Y D -0.0620
945 A D -1.0611
946 Q D -2.8232
947 K D -3.4011
948 F D 0.0000
949 R D -2.9925
950 G D -2.3634
951 R D -3.0460
952 V D 0.0000
953 T D -1.0904
954 M D 0.0000
955 T D -0.2532
956 R D 0.0000
957 D D -0.0812
958 T D 0.3012
959 S D 0.5513
960 I D 1.4625
961 S D 0.2499
962 T D 0.0000
963 A D 0.0000
964 Y D -0.7167
965 M D 0.0000
966 E D -1.8122
967 L D 0.0000
968 S D -2.0490
969 R D -2.8920
970 L D 0.0000
971 R D -3.6227
972 S D -2.5749
973 D D -2.7170
974 D D 0.0000
975 T D -0.9785
976 A D 0.0000
977 V D 0.0374
978 Y D 0.0000
979 Y D 0.0000
980 C D 0.0000
981 A D 0.0000
982 R D -0.1347
983 E D -0.2676
984 P D -0.2828
985 E D -0.4618
986 K D 0.0000
987 F D 0.0000
988 D D 0.0000
989 S D 0.0000
990 D D -2.0709
991 D D -2.4116
992 S D 0.0000
993 D D 0.0000
994 V D 0.0000
995 W D 0.0000
996 G D 0.0000
997 R D -2.2870
998 G D -0.8879
999 T D -0.5084
1000 L D 0.0849
1001 V D 0.0000
1002 T D 0.0000
1003 V D 0.0000
1004 S D -1.2819
1005 S D -0.9947
1006 A D -0.7046
1007 S D -0.8336
1008 T D -0.7953
1009 K D -1.4467
1010 G D -1.4799
1011 P D -0.7859
1012 S D -0.5927
1013 V D 0.0000
1014 F D 0.0000
1015 P D -1.2103
1016 L D 0.0000
1017 A D 0.0000
1018 P D -0.8185
1019 S D -0.8416
1020 S D -1.2685
1021 K D -2.0053
1022 S D -1.2696
1023 T D -0.9759
1024 S D -0.8811
1025 G D -0.7705
1026 G D -0.6977
1027 T D -0.5171
1028 A D -0.3881
1029 A D -0.0376
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.4994
1036 D D -0.8585
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.6200
1041 P D -0.6715
1042 V D -0.5790
1043 T D -0.5296
1044 V D 0.0671
1045 S D -0.2805
1046 W D 0.0000
1047 N D -0.7253
1048 S D -0.6092
1049 G D -0.3512
1050 A D -0.1129
1051 L D 0.1329
1052 T D -0.0455
1053 S D -0.0930
1054 G D -0.0717
1055 V D 0.3502
1056 H D -0.1371
1057 T D 0.0122
1058 F D 0.0000
1059 P D 0.0550
1060 A D 0.3282
1061 V D 0.8468
1062 L D 1.1786
1063 Q D -0.0063
1064 S D -0.2068
1065 S D -0.3549
1066 G D 0.0000
1067 L D -0.0139
1068 Y D 0.0000
1069 S D 0.0000
1070 L D 0.0000
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0682
1076 V D 0.0000
1077 P D -0.5630
1078 S D -0.5863
1079 S D -0.6603
1080 S D -0.7745
1081 L D -0.9263
1082 G D -1.1954
1083 T D -0.9212
1084 Q D -1.3621
1085 T D -1.3624
1086 Y D 0.0000
1087 I D -1.4741
1088 C D 0.0000
1089 N D -1.4863
1090 V D 0.0000
1091 N D -1.9636
1092 H D 0.0000
1093 K D -2.6766
1094 P D -1.7738
1095 S D -1.8998
1096 N D -2.5085
1097 T D -2.1232
1098 K D -2.6450
1099 V D -1.7254
1100 D D -2.5618
1101 K D -2.1061
1102 K D -2.7491
1103 V D 0.0000
1104 E D -2.6487
1105 P D -1.6045
1106 K D -1.1801
1107 S D -1.3455
1108 C D -0.9675
1109 D D -2.4087
1110 K D -2.4926
1111 T D -1.5011
1112 H D 0.0000
1113 T D -0.7890
1114 C D -1.1019
1115 P D -1.1945
1116 P D -0.7316
1117 C D -0.5503
1118 P D -0.6006
1119 A D -1.0067
1120 P D -1.0669
1121 E D -1.2761
1122 L D 0.2135
1123 L D 1.2719
1124 G D 0.0886
1125 G D -0.0265
1126 P D -0.1523
1127 S D 0.1900
1128 V D 0.0000
1129 F D 2.0399
1130 L D 0.0000
1131 F D 2.0867
1132 P D 0.5041
1133 P D 0.0000
1134 K D -1.8794
1135 P D -1.2892
1136 K D -1.0577
1137 D D 0.0000
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.8583
1141 I D 1.5965
1142 S D 0.1464
1143 R D -0.9448
1144 T D -0.4484
1145 P D 0.0000
1146 E D -0.7238
1147 V D 0.0000
1148 T D 1.0144
1149 C D 0.0000
1150 V D 0.6950
1151 V D 0.0000
1152 V D 0.1385
1153 D D -0.3151
1154 V D 0.0000
1155 S D -1.5215
1156 H D -2.1172
1157 E D -2.8703
1158 D D -2.2836
1159 P D -2.5119
1160 E D -3.0851
1161 V D 0.0000
1162 K D -2.6116
1163 F D 0.0000
1164 N D -1.3127
1165 W D 0.0000
1166 Y D -1.0326
1167 V D -0.9122
1168 D D -2.1120
1169 G D -0.7350
1170 V D 0.9158
1171 E D -0.1838
1172 V D 0.3866
1173 H D -1.1454
1174 N D -1.0890
1175 A D -1.0877
1176 K D -2.0994
1177 T D 0.0000
1178 K D -2.1590
1179 P D -1.9042
1180 R D -2.6079
1181 E D -2.3877
1182 E D -1.6820
1183 Q D -1.3306
1184 Y D 0.0272
1185 N D -0.2185
1186 S D -0.3619
1187 T D -0.5106
1188 Y D -1.1137
1189 R D -1.4831
1190 V D 0.0000
1191 V D -0.5757
1192 S D 0.0000
1193 V D 0.0444
1194 L D 0.0000
1195 T D -0.2331
1196 V D 0.4887
1197 L D 1.1157
1198 H D 0.0494
1199 Q D -1.0075
1200 D D -1.0314
1201 W D 0.0000
1202 L D -0.9718
1203 N D -2.0475
1204 G D -2.1230
1205 K D -2.2711
1206 E D -2.6285
1207 Y D 0.0000
1208 K D -2.0478
1209 C D 0.0000
1210 K D -1.7550
1211 V D 0.0000
1212 S D -1.4580
1213 N D -1.8851
1214 K D -2.0689
1215 A D -1.2442
1216 L D -0.5967
1217 P D -0.4695
1218 A D -0.2852
1219 P D -0.4326
1220 I D -0.4127
1221 E D -1.4718
1222 K D -1.4046
1223 T D -1.2595
1224 I D -0.0555
1225 S D -1.7259
1226 K D -1.6773
1227 A D -1.4260
1228 K D -2.4221
1229 G D -2.1376
1230 Q D -2.1703
1231 P D -2.2813
1232 R D -2.8378
1233 E D -2.7648
1234 P D 0.0000
1235 Q D -1.3193
1236 V D 0.0000
1237 Y D 0.0000
1238 T D 0.0000
1239 L D -0.1390
1240 P D -0.3131
1241 P D 0.0000
1242 S D -1.1488
1243 R D -2.2236
1244 E D -2.0090
1245 E D 0.0000
1246 M D -1.1503
1247 T D -1.3206
1248 K D -2.1889
1249 N D -2.6317
1250 Q D -2.6662
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D -0.5962
1259 G D -1.0959
1260 F D 0.0000
1261 Y D -1.3312
1262 P D 0.0000
1263 S D -0.1613
1264 D D -0.9515
1265 I D 0.0000
1266 A D -0.4724
1267 V D 0.0000
1268 E D -1.2131
1269 W D 0.0000
1270 E D -1.9088
1271 S D 0.0000
1272 N D -2.2809
1273 G D -1.8978
1274 Q D -2.2959
1275 P D -2.1286
1276 E D -2.5391
1277 N D -2.2703
1278 N D -1.8045
1279 Y D -1.1714
1280 K D -0.8970
1281 T D -0.4897
1282 T D 0.0000
1283 P D -0.0212
1284 P D 0.2762
1285 V D 0.7667
1286 L D 0.8290
1287 D D -0.4701
1288 S D -1.3619
1289 D D -2.0061
1290 G D -0.8831
1291 S D 0.0000
1292 F D 0.1417
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D -1.0260
1300 V D 0.0000
1301 D D -2.7545
1302 K D -3.0784
1303 S D -2.7770
1304 R D -3.4943
1305 W D 0.0000
1306 Q D -2.7168
1307 Q D -2.7147
1308 G D -1.5872
1309 N D -1.4822
1310 V D -0.5546
1311 F D 0.0000
1312 S D -1.1836
1313 C D 0.0000
1314 S D -0.7122
1315 V D 0.0000
1316 M D -0.4038
1317 H D 0.0000
1318 E D -1.2174
1319 A D -1.8937
1320 L D 0.0000
1321 H D -1.6607
1322 N D -1.5364
1323 H D -0.9063
1324 Y D -0.0118
1325 T D -0.7928
1326 Q D -1.2970
1327 K D -1.2055
1328 S D -0.4574
1329 L D 0.0000
1330 S D 0.2805
1331 L D 1.0266
1332 S D 0.2239
1333 P D -0.3834
1334 G D -0.5339

 

Laboratory of Theory of Biopolymers 2015