Project name: 3bf025bcc309d67

Status: done

submitted: 2017-03-10 14:57:26, status changed: 2017-03-10 15:07:46
Settings
Chain sequence(s) A: PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.737
Maximal score value
1.8036
Average score
-0.7175
Total score value
-164.2989

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 P A -0.5633
8 L A -0.5426
9 F A 0.0000
10 A A -0.6945
11 P A -1.2593
12 G A -1.7836
13 E A -2.0215
14 D A -2.5727
15 C A 0.0000
16 G A -1.0065
17 P A -0.9043
18 A A -0.7374
19 W A 0.0000
20 R A -2.1352
21 A A -1.1131
22 A A 0.0000
23 P A -0.6300
24 A A -0.7907
25 A A -0.4803
26 Y A -0.6765
27 D A -1.1983
28 T A -0.7114
29 S A -0.8202
30 D A -0.9877
31 T A -0.8873
32 H A -1.0244
33 L A 0.0000
34 Q A -0.7996
35 I A 0.0000
36 L A 0.2557
37 G A -0.2749
38 K A 0.0000
39 P A 0.0000
40 V A -0.0316
41 M A 0.0000
42 E A 0.0000
43 R A -0.8977
44 W A -0.0419
45 E A 0.0000
46 T A -0.4186
47 P A -0.2552
48 Y A 0.0000
49 M A 0.0000
50 H A -0.5708
51 S A -0.5029
52 L A 0.0000
53 A A 0.0000
54 A A -0.5422
55 A A -0.2178
56 A A 0.0000
57 A A 0.0000
58 S A -0.7889
59 R A -1.3908
60 G A -1.3398
61 G A -1.4628
62 R A -1.4886
63 V A 0.0000
64 L A 0.0000
65 E A 0.0000
66 V A 0.0000
67 G A -0.1509
68 F A 0.0000
69 G A -0.2900
70 M A 0.0000
71 A A -0.3625
72 I A 0.0000
73 A A 0.0000
74 A A 0.0000
75 S A -0.8189
76 R A -1.3506
77 V A 0.0000
78 Q A 0.0000
79 Q A -1.6471
80 A A -1.3235
81 P A -1.2126
82 I A 0.0000
83 K A -2.5152
84 E A -1.8869
85 H A 0.0000
86 W A -0.0503
87 I A 0.0000
88 I A 0.0000
89 E A 0.0000
90 C A -1.4228
91 N A 0.0000
92 D A -2.2010
93 G A -1.5011
94 V A 0.0000
95 F A -1.9362
96 Q A -2.5747
97 R A -2.2209
98 L A 0.0000
99 Q A -1.7518
100 N A -2.0065
101 W A -1.1378
102 A A -0.9414
103 L A -0.0675
104 K A -1.3952
105 Q A -1.3844
106 P A -1.4790
107 H A -2.1585
108 K A -2.1552
109 V A 0.0000
110 V A -0.2953
111 P A -0.4537
112 L A -0.4840
113 K A -2.1206
114 G A -1.6932
115 L A -1.4180
116 W A 0.0000
117 E A -2.2390
118 E A -2.5594
119 V A -1.3778
120 A A 0.0000
121 P A -1.2057
122 T A -0.8414
123 L A 0.0000
124 P A -1.3564
125 D A -2.2685
126 G A -1.6744
127 H A -1.3222
128 F A 0.0000
129 D A -1.1045
130 G A 0.0000
131 I A 0.0000
132 L A 0.0000
133 Y A 0.0000
134 D A -0.4153
135 T A -0.1499
136 Y A 0.0000
137 P A 0.0000
138 L A -0.7730
139 S A -1.8971
140 E A -2.2198
141 E A -2.6469
142 T A -1.5220
143 W A 0.0000
144 H A -0.7830
145 T A -0.7410
146 H A 0.0000
147 Q A 0.0000
148 F A -0.9834
149 N A -1.5597
150 F A 0.0000
151 I A 0.0000
152 K A -1.8780
153 T A -1.1017
154 H A 0.0000
155 A A 0.0000
156 F A -0.4693
157 R A -1.3124
158 L A 0.0000
159 L A 0.0000
160 K A -1.5847
161 P A -1.1049
162 G A -1.1971
163 G A 0.0000
164 I A 0.0000
165 L A 0.0000
166 T A 0.0000
167 Y A 0.0000
168 C A 0.0000
169 N A 0.0000
170 L A 0.0000
171 T A 0.0000
172 S A 0.0000
173 W A 0.0000
174 G A 0.0000
175 E A -1.6829
176 L A -1.2652
177 M A 0.0000
178 K A -2.3591
179 S A -1.9402
180 K A -2.4233
181 Y A -1.6372
182 T A -1.3154
183 D A -1.6918
184 I A 0.0000
185 T A -1.2395
186 A A -1.6377
187 M A 0.0000
188 F A 0.0000
189 E A -2.4665
190 E A -2.5784
191 T A -1.3818
192 Q A 0.0000
193 V A 0.0000
194 P A -1.1121
195 A A 0.0000
196 L A 0.0000
197 L A -1.0607
198 E A -2.0625
199 A A -1.6247
200 G A -1.3854
201 F A 0.0000
202 Q A -2.5519
203 R A -2.2238
204 E A -2.7370
205 N A -1.8352
206 I A 0.0000
207 C A -0.1485
208 T A -0.4287
209 E A -1.1113
210 V A 0.1630
211 M A 0.3880
212 A A 0.6960
213 L A 1.0758
214 V A 1.8036
215 P A 0.3870
216 P A -0.4468
217 A A -0.9274
218 D A -2.2905
219 C A 0.0000
220 R A -2.3999
221 Y A 0.0000
222 Y A 0.0000
223 A A -0.5424
224 F A -0.0293
225 P A 0.6909
226 Q A 0.2285
227 M A 0.0000
228 I A 0.0000
229 T A 0.0000
230 P A 0.0000
231 L A 0.0810
232 V A 0.0000
233 T A -1.0105
234 K A -1.5033
235 H A -1.7568

 

Laboratory of Theory of Biopolymers 2015