Project name: hhhhhhhhh

Status: done

submitted: 2018-01-12 16:09:19, status changed: 2018-01-12 16:11:26
Settings
Chain sequence(s) A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4231
Maximal score value
0.9246
Average score
-1.2593
Total score value
-71.7827

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 K A -2.1875
7 E A -2.0823
8 L A -0.4358
9 V A 0.0000
10 L A 0.1467
11 A A 0.0000
12 L A -0.2747
13 Y A -0.7137
14 D A -2.5742
15 Y A 0.0000
16 Q A -2.3607
17 E A -2.2610
18 K A -2.5178
19 S A -1.6514
20 P A -1.2878
21 R A -1.7891
22 E A 0.0000
23 V A 0.0000
24 T A -1.8293
25 M A 0.0000
26 K A -3.0219
27 K A -2.5281
28 G A -1.3584
29 D A -0.9662
30 I A 0.9246
31 L A 0.0000
32 T A -0.7349
33 L A 0.0000
34 L A -0.8093
35 N A -1.0918
36 S A -1.4294
37 T A -1.5873
38 N A -2.8405
39 K A -3.1632
40 D A -2.8163
41 W A -1.5166
42 W A -1.0357
43 K A -1.0907
44 V A 0.0000
45 E A -1.9168
46 V A -2.1106
47 N A -2.5903
48 D A -3.4231
49 R A -3.2815
50 Q A -2.7747
51 G A 0.0000
52 F A -0.7592
53 V A 0.0000
54 P A -0.5882
55 A A -1.2652
56 A A -0.3224
57 Y A 0.1213
58 V A 0.0000
59 K A -1.3287
60 K A -1.6113
61 L A -0.8165
62 D A -2.2312

 

Laboratory of Theory of Biopolymers 2015