Project name: 403984a8a455679

Status: done

submitted: 2017-11-14 10:16:24, status changed: 2017-11-14 11:44:15
Settings
Chain sequence(s) A: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCGPQLTAKLGFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: ELQMTQSPSSLSASVGDRVTITCRTSQSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCGPQLTAKLGFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.6224
Maximal score value
2.1085
Average score
-0.7924
Total score value
-1063.4418

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.6902
2 L A -0.0996
3 Q A 0.0000
4 M A -0.4572
5 T A 0.0000
6 Q A -1.3470
7 S A -0.9492
8 P A -1.1587
9 S A -1.1075
10 S A -0.9912
11 L A -0.4090
12 S A -0.4398
13 A A -0.9230
14 S A -0.9603
15 V A 0.0325
16 G A -1.0957
17 D A -2.4732
18 R A -2.6981
19 V A 0.0000
20 T A -0.7865
21 I A 0.0000
22 T A 0.0000
23 C A 0.0000
24 R A -1.8397
25 T A 0.0000
26 S A -1.1573
27 Q A -1.8392
28 S A -1.3187
29 I A 0.0000
30 S A -0.3109
31 S A 0.0721
32 Y A 0.5311
33 L A 0.0000
34 N A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A -1.1179
38 Q A -1.5829
39 K A -2.0082
40 P A -1.4457
41 G A -1.2667
42 Q A -1.7615
43 P A -1.4950
44 P A 0.0000
45 K A -2.0571
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.3226
50 W A 0.6965
51 A A 0.0450
52 S A -0.3012
53 T A -0.4327
54 R A -1.6565
55 E A -1.0102
56 S A -0.7135
57 G A -0.9203
58 V A -0.9275
59 P A -1.2904
60 D A -2.1744
61 R A -1.4210
62 F A 0.0000
63 S A -0.8428
64 G A -0.3485
65 S A -0.3757
66 G A -0.7351
67 S A -0.7111
68 G A -1.0598
69 T A -1.4040
70 D A -1.4225
71 F A 0.0000
72 T A -0.6486
73 L A 0.0000
74 T A -0.5544
75 I A 0.0000
76 S A -1.6418
77 S A -1.3331
78 L A 0.0000
79 Q A -0.8928
80 P A -1.4815
81 E A -2.2160
82 D A 0.0000
83 S A -1.4048
84 A A 0.0000
85 T A -1.2609
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 G A 0.0000
90 P A 0.0000
91 Q A -0.0834
92 L A 0.1816
93 T A -0.4443
94 A A -0.6916
95 K A -1.9599
96 L A -0.9492
97 G A -0.7964
98 F A 0.0000
99 G A 0.0000
100 Q A -1.8208
101 G A -1.5353
102 T A 0.0000
103 K A -1.9701
104 L A 0.0000
105 E A 0.0000
106 I A -0.8029
107 K A -1.2797
108 R A -1.9345
109 T A -0.3666
110 V A 0.8979
111 A A 0.2249
112 A A 0.0445
113 P A -0.1931
114 S A -0.2119
115 V A -0.0825
116 F A 0.1805
117 I A 0.0000
118 F A 0.0000
119 P A -0.4343
120 P A 0.0000
121 S A -1.5751
122 D A -2.7982
123 E A -2.2503
124 Q A 0.0000
125 L A 0.0000
126 K A -2.8798
127 S A -1.6337
128 G A -1.1571
129 T A -0.8924
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -1.3690
139 F A 0.0000
140 Y A 0.0000
141 P A -1.4805
142 R A -2.3397
143 E A -2.9379
144 A A -2.3321
145 K A -2.4828
146 V A -1.4080
147 Q A -1.0901
148 W A 0.0000
149 K A -0.3710
150 V A -0.7060
151 D A -1.4751
152 N A -1.2524
153 A A -0.2295
154 L A 0.5838
155 Q A -0.7143
156 S A -0.6046
157 G A -1.1164
158 N A -1.9001
159 S A -1.5007
160 Q A -1.2104
161 E A -1.6788
162 S A 0.0000
163 V A 0.1153
164 T A -0.7331
165 E A -2.1308
166 Q A -2.3373
167 D A -2.9565
168 S A -2.6756
169 K A -3.0514
170 D A -3.4702
171 S A -2.9397
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5208
181 L A -0.6140
182 S A -1.1712
183 K A -1.9153
184 A A -1.9304
185 D A -2.4541
186 Y A 0.0000
187 E A -3.2275
188 K A -3.4117
189 H A -2.7539
190 K A -2.8291
191 V A -1.2677
192 Y A 0.0000
193 A A -0.8761
194 C A 0.0000
195 E A -1.2414
196 V A 0.0000
197 T A -1.2670
198 H A 0.0000
199 Q A -1.7355
200 G A -0.4372
201 L A -0.1504
202 S A -0.4522
203 S A -0.3804
204 P A -0.6071
205 V A -0.1008
206 T A -0.6574
207 K A -0.9763
208 S A -0.7801
209 F A 0.0000
210 N A -1.6807
211 R A -2.3115
212 G A -1.7719
213 E A -2.1973
214 C A -1.9324
215 E B -1.8158
216 V B -0.6869
217 Q B -1.1779
218 L B 0.0000
219 L B 0.3714
220 E B -0.1056
221 S B -0.6022
222 G B -0.8587
223 G B 0.0000
224 G B -0.0541
225 V B 0.2147
226 V B 0.0000
227 Q B -2.0174
228 P B -2.1852
229 G B -2.2884
230 R B -2.7861
231 S B -2.0077
232 L B -1.3637
233 R B -2.0521
234 L B 0.0000
235 S B -0.6137
236 C B 0.0000
237 A B -0.2015
238 A B 0.0000
239 S B -0.8246
240 G B -0.8458
241 F B -0.0227
242 T B -0.0241
243 F B 0.0000
244 S B -0.9804
245 S B -0.2071
246 Y B 0.1327
247 G B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B 0.0000
253 Q B -1.0564
254 A B -1.3292
255 P B -1.0436
256 G B -1.4644
257 K B -2.5204
258 G B -1.8663
259 L B -1.2678
260 E B -1.8668
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.1593
265 I B 0.0000
266 S B -0.8712
267 Y B -0.8219
268 D B -2.0375
269 G B -1.6460
270 S B -1.3775
271 N B -1.6020
272 K B -0.6851
273 Y B 0.3280
274 Y B -0.6783
275 A B -1.6716
276 D B -2.7814
277 S B -2.0670
278 V B 0.0000
279 K B -2.7093
280 G B -2.0968
281 R B -2.5444
282 F B 0.0000
283 T B -1.2226
284 I B 0.0000
285 S B -0.5433
286 R B -1.1070
287 D B -1.7018
288 N B -2.0040
289 S B -1.6720
290 K B -2.3988
291 N B -1.7544
292 T B -0.9801
293 L B 0.0000
294 Y B -0.5650
295 L B 0.0000
296 Q B -1.5552
297 M B 0.0000
298 N B -2.0634
299 S B -1.9348
300 L B 0.0000
301 R B -3.1820
302 A B -2.0561
303 E B -2.4690
304 D B 0.0000
305 T B -0.7856
306 A B 0.0000
307 V B 0.0323
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 D B 0.2183
314 M B 0.5415
315 G B 0.6649
316 W B 1.6312
317 G B 0.0000
318 S B 0.9442
319 G B 0.3475
320 W B 0.6699
321 R B -0.8681
322 P B 0.1867
323 Y B 1.5691
324 Y B 1.6724
325 Y B 1.5847
326 Y B 0.9677
327 G B 0.0000
328 M B 0.0000
329 D B -0.4190
330 V B -0.5278
331 W B 0.0000
332 G B 0.0000
333 Q B -1.2203
334 G B -0.6218
335 T B -0.3199
336 T B -0.2207
337 V B 0.0000
338 T B -0.3151
339 V B 0.0000
340 S B -0.9084
341 S B -0.6888
342 A B -0.6146
343 S B -0.8827
344 T B -1.1715
345 K B -2.0691
346 G B -1.7112
347 P B -0.8718
348 S B -0.4930
349 V B 0.0000
350 F B 0.0000
351 P B -1.2583
352 L B 0.0000
353 A B -0.9754
354 P B -0.6003
355 S B 0.0000
356 S B -1.0518
357 K B -1.3069
358 S B -0.9614
359 T B -0.6768
360 S B -0.8172
361 G B -0.7762
362 G B -0.7132
363 T B -0.5365
364 A B 0.0000
365 A B 0.0000
366 L B 0.0000
367 G B 0.0000
368 C B 0.0000
369 L B 0.0000
370 V B 0.0000
371 K B -0.4437
372 D B -0.8511
373 Y B 0.0000
374 F B 0.0000
375 P B 0.0000
376 E B -1.4391
377 P B -1.2561
378 V B -0.8204
379 T B -0.6083
380 V B -0.2692
381 S B -0.2682
382 W B 0.0000
383 N B -0.7648
384 S B -0.6031
385 G B -0.3375
386 A B -0.1597
387 L B 0.0667
388 T B -0.0826
389 S B -0.1239
390 G B -0.2267
391 V B 0.3975
392 H B -0.1794
393 T B 0.1380
394 F B 0.0000
395 P B -0.0828
396 A B 0.3392
397 V B 0.6419
398 L B 1.0624
399 Q B -0.2970
400 S B -0.2801
401 S B -0.4092
402 G B 0.0000
403 L B -0.1740
404 Y B -0.0335
405 S B -0.0482
406 L B 0.0000
407 S B 0.0000
408 S B 0.0000
409 V B 0.0000
410 V B 0.0000
411 T B -0.0490
412 V B 0.0000
413 P B -0.6019
414 S B -0.6394
415 S B -0.6904
416 S B -0.7487
417 L B 0.0000
418 G B -1.1722
419 T B -0.8079
420 Q B -1.1064
421 T B -1.2156
422 Y B 0.0000
423 I B -1.3799
424 C B 0.0000
425 N B -1.5090
426 V B 0.0000
427 N B -1.9463
428 H B 0.0000
429 K B -2.8400
430 P B -1.8137
431 S B -2.0147
432 N B -2.5489
433 T B -2.1361
434 K B -2.6325
435 V B -1.7718
436 D B -2.6119
437 K B -2.2294
438 K B -2.7703
439 V B 0.0000
440 E B -2.9348
441 P B -2.2882
442 K B -2.8666
443 S B -2.1068
444 C B -1.9418
445 D B -2.4182
446 K B -2.6724
447 T B -1.9501
448 H B -1.8127
449 T B -1.3221
450 C B -1.2883
451 P B 0.0000
452 P B -0.3220
453 C B 0.2085
454 P B -0.3697
455 A B -0.3522
456 P B -0.5047
457 E B -0.9185
458 L B 0.8001
459 L B 1.3395
460 G B 0.3158
461 G B -0.0677
462 P B 0.0000
463 S B 0.1135
464 V B 0.0000
465 F B 1.2388
466 L B 0.7827
467 F B 1.0226
468 P B -0.0653
469 P B 0.0000
470 K B -1.9687
471 P B -1.1808
472 K B -1.0116
473 D B -1.0665
474 T B 0.0000
475 L B 0.0000
476 M B 0.6544
477 I B 1.6168
478 S B -0.0219
479 R B -1.2539
480 T B -0.4290
481 P B 0.0000
482 E B -0.8234
483 V B 0.0000
484 T B 0.6607
485 C B 0.0000
486 V B 0.0000
487 V B 0.0000
488 V B 0.0905
489 D B -0.6855
490 V B 0.0000
491 S B -1.6927
492 H B -2.0080
493 E B -2.6737
494 D B 0.0000
495 P B -1.9786
496 E B -2.0830
497 V B 0.0000
498 K B -2.1663
499 F B 0.0000
500 N B -1.7864
501 W B 0.0000
502 Y B -1.2809
503 V B -0.8980
504 D B -2.1056
505 G B -0.7798
506 V B 0.6796
507 E B -0.7776
508 V B 0.2634
509 H B -1.2003
510 N B -1.0799
511 A B -0.9744
512 K B -2.1936
513 T B -1.3545
514 K B -1.9425
515 P B -1.9512
516 R B -3.2061
517 E B -3.1047
518 E B -3.2160
519 Q B -2.3196
520 Y B -0.9425
521 N B -1.2731
522 S B -0.9803
523 T B -1.3022
524 Y B -1.9961
525 R B -1.9360
526 V B 0.0000
527 V B -0.8288
528 S B 0.0000
529 V B 0.1239
530 L B 0.0000
531 T B -0.1989
532 V B 0.5124
533 L B 1.0674
534 H B -0.0082
535 Q B -1.2293
536 D B -1.0469
537 W B 0.0000
538 L B -0.8890
539 N B -1.9880
540 G B -2.0258
541 K B -2.1813
542 E B -2.1358
543 Y B 0.0000
544 K B -2.1138
545 C B 0.0000
546 K B -1.9780
547 V B 0.0000
548 S B -1.3412
549 N B -1.6206
550 K B -2.0263
551 A B -1.1935
552 L B -0.5804
553 P B -0.4562
554 A B -0.3780
555 P B -0.5644
556 I B -0.7217
557 E B -1.7511
558 K B -1.9018
559 T B -1.3761
560 I B -0.1983
561 S B -1.4912
562 K B -1.3483
563 A B -1.2731
564 K B -2.3296
565 G B -2.1001
566 Q B -2.1613
567 P B -2.2362
568 R B -2.8086
569 E B -2.8282
570 P B 0.0000
571 Q B -1.3424
572 V B 0.0000
573 Y B -0.8467
574 T B -0.5637
575 L B -0.2537
576 P B -0.3673
577 P B 0.0000
578 S B -1.3903
579 R B -2.6228
580 D B -2.8225
581 E B 0.0000
582 L B -1.4224
583 T B -1.5497
584 K B -2.5697
585 N B -2.7323
586 Q B -2.4515
587 V B 0.0000
588 S B -0.2976
589 L B 0.0000
590 T B 0.0000
591 C B 0.0000
592 L B 0.0000
593 V B 0.0000
594 K B -0.6338
595 G B -1.1316
596 F B 0.0000
597 Y B -1.3378
598 P B 0.0000
599 S B 0.0415
600 D B -0.6861
601 I B -0.4798
602 A B -0.4408
603 V B 0.0000
604 E B -1.2893
605 W B 0.0000
606 E B -2.0911
607 S B 0.0000
608 N B -2.1170
609 G B -1.9149
610 Q B -2.2717
611 P B -2.0391
612 E B -2.2369
613 N B -2.1805
614 N B -1.8539
615 Y B -1.2034
616 K B -0.9206
617 T B -0.4924
618 T B 0.0000
619 P B -0.0489
620 P B 0.2329
621 V B 0.6003
622 L B 0.5842
623 D B -0.4628
624 S B -1.2736
625 D B -1.9431
626 G B -0.8592
627 S B -0.7994
628 F B 0.0649
629 F B 0.0000
630 L B 0.0000
631 Y B 0.0000
632 S B 0.0000
633 K B 0.0000
634 L B 0.0000
635 T B -1.0400
636 V B 0.0000
637 D B -2.8106
638 K B -2.5957
639 S B -2.1622
640 R B -2.3835
641 W B 0.0000
642 Q B -2.7085
643 Q B -2.5671
644 G B -1.5946
645 N B -1.3894
646 V B -0.5565
647 F B 0.0000
648 S B -1.1891
649 C B 0.0000
650 S B -0.9042
651 V B 0.0000
652 M B 0.0000
653 H B 0.0000
654 E B -1.1272
655 A B -1.9028
656 L B 0.0000
657 H B -1.8629
658 N B -1.7551
659 H B -1.2166
660 Y B -0.7159
661 T B -1.1205
662 Q B -1.3375
663 K B -1.1318
664 S B -0.4700
665 L B 0.0000
666 S B -0.0529
667 L B 0.9215
668 S B 0.0940
669 P B -0.4482
670 G B -0.4339
671 K B -1.2316
672 E C -1.8150
673 L C -0.4893
674 Q C 0.0000
675 M C -0.8594
676 T C 0.0000
677 Q C -1.2501
678 S C -0.8580
679 P C -1.1400
680 S C -1.1429
681 S C -1.1087
682 L C -0.5523
683 S C -0.7933
684 A C 0.0000
685 S C -0.6426
686 V C 0.3919
687 G C -0.7294
688 D C -1.7367
689 R C -2.3577
690 V C 0.0000
691 T C -0.6430
692 I C 0.0000
693 T C -0.9903
694 C C 0.0000
695 R C -2.4495
696 T C 0.0000
697 S C -1.4085
698 Q C -1.9820
699 S C -1.3725
700 I C 0.0000
701 S C -0.1985
702 S C 0.0333
703 Y C 0.7338
704 L C 0.0000
705 N C 0.0000
706 W C 0.0000
707 Y C 0.0000
708 Q C 0.0000
709 Q C -1.5108
710 K C -1.9417
711 P C -1.5475
712 G C -1.4752
713 Q C -2.2088
714 P C -1.7039
715 P C 0.0000
716 K C -2.1249
717 L C 0.0000
718 L C 0.0000
719 I C 0.0000
720 Y C 0.1259
721 W C 0.3405
722 A C -0.0368
723 S C -0.3506
724 T C -0.6056
725 R C -1.6408
726 E C -1.1814
727 S C -0.7962
728 G C -1.0850
729 V C -1.0995
730 P C -1.3028
731 D C -2.2083
732 R C -1.4872
733 F C 0.0000
734 S C -0.8529
735 G C -0.3696
736 S C -0.5009
737 G C -0.9665
738 S C -0.9110
739 G C -1.2512
740 T C -1.8123
741 D C -2.1607
742 F C 0.0000
743 T C -0.7941
744 L C 0.0000
745 T C -0.5621
746 I C 0.0000
747 S C -1.5284
748 S C -1.0817
749 L C 0.0000
750 Q C -0.8543
751 P C -1.5378
752 E C -2.2015
753 D C 0.0000
754 S C -1.4771
755 A C 0.0000
756 T C -1.1874
757 Y C 0.0000
758 Y C 0.0000
759 C C 0.0000
760 G C 0.0000
761 P C 0.0000
762 Q C 0.1162
763 L C 0.3721
764 T C -0.3603
765 A C -0.7006
766 K C -1.9670
767 L C -0.9693
768 G C -0.8575
769 F C 0.0000
770 G C 0.0000
771 Q C -1.7526
772 G C -1.5288
773 T C 0.0000
774 K C -2.0714
775 L C 0.0000
776 E C -1.3496
777 I C -0.9366
778 K C -1.1662
779 R C -1.0512
780 T C 0.0316
781 V C 1.0694
782 A C 0.4395
783 A C 0.1213
784 P C -0.1149
785 S C -0.2936
786 V C 0.0000
787 F C 0.1751
788 I C 0.0000
789 F C 0.0000
790 P C -0.5912
791 P C 0.0000
792 S C 0.0000
793 D C -2.5538
794 E C -2.0509
795 Q C 0.0000
796 L C -1.9611
797 K C -2.5067
798 S C -1.5175
799 G C -1.0827
800 T C -0.7946
801 A C 0.0000
802 S C 0.0000
803 V C 0.0000
804 V C 0.0000
805 C C 0.0000
806 L C 0.0000
807 L C 0.0000
808 N C 0.0000
809 N C -0.9303
810 F C 0.0000
811 Y C 0.0000
812 P C -1.5691
813 R C -2.8831
814 E C -3.1559
815 A C -2.4382
816 K C -2.5105
817 V C 0.0000
818 Q C -0.9167
819 W C 0.0000
820 K C -0.5770
821 V C -0.8059
822 D C -1.5252
823 N C -1.3302
824 A C -0.3152
825 L C 0.4013
826 Q C -0.9679
827 S C -0.7962
828 G C -1.2678
829 N C -1.9662
830 S C -1.4827
831 Q C -1.0947
832 E C -1.4331
833 S C -0.4148
834 V C -0.5084
835 T C 0.0000
836 E C -2.4386
837 Q C -2.5645
838 D C -2.9406
839 S C -2.6552
840 K C -2.7854
841 D C -2.6841
842 S C -2.5524
843 T C 0.0000
844 Y C 0.0000
845 S C 0.0000
846 L C -0.5194
847 S C 0.0000
848 S C 0.0000
849 T C 0.0000
850 L C 0.0000
851 T C -0.5694
852 L C -0.5941
853 S C -1.1399
854 K C -1.9565
855 A C -1.9346
856 D C -2.2001
857 Y C 0.0000
858 E C -3.6224
859 K C -3.4900
860 H C -3.0230
861 K C -3.1643
862 V C -1.4377
863 Y C 0.0000
864 A C -0.8687
865 C C 0.0000
866 E C -0.9733
867 V C 0.0000
868 T C -1.1495
869 H C 0.0000
870 Q C -1.7232
871 G C -0.3772
872 L C -0.0426
873 S C -0.3911
874 S C -0.3281
875 P C -0.4776
876 V C -0.0244
877 T C -0.5369
878 K C -0.9174
879 S C -0.7379
880 F C 0.0000
881 N C -1.7326
882 R C -2.2612
883 G C -1.6731
884 E C -1.5815
885 C C -1.0177
886 E D -1.8152
887 V D -0.7355
888 Q D -0.9242
889 L D 0.0000
890 L D 0.8973
891 E D 0.0000
892 S D -0.4538
893 G D -0.8479
894 G D -0.5920
895 G D -0.1513
896 V D 0.0267
897 V D 0.0000
898 Q D -2.0740
899 P D -2.2879
900 G D -2.3999
901 R D -2.8335
902 S D -2.1248
903 L D -1.3181
904 R D -2.0399
905 L D 0.0000
906 S D -0.5274
907 C D 0.0000
908 A D -0.0302
909 A D 0.0000
910 S D -0.6738
911 G D -0.6541
912 F D 0.0323
913 T D -0.0339
914 F D 0.0000
915 S D -0.9861
916 S D -0.4941
917 Y D 0.0000
918 G D 0.0000
919 M D 0.0000
920 H D 0.0000
921 W D 0.0000
922 V D 0.0000
923 R D -0.7781
924 Q D -1.1445
925 A D -1.3966
926 P D -1.0712
927 G D -1.4776
928 K D -2.4928
929 G D -1.8300
930 L D 0.0000
931 E D -1.5128
932 W D 0.0000
933 V D 0.0000
934 A D 0.0000
935 V D 0.0000
936 I D 0.0000
937 S D -1.0513
938 Y D -1.1269
939 D D -2.0791
940 G D -1.7432
941 S D -1.4759
942 N D -1.7719
943 K D -1.0078
944 Y D 0.0597
945 Y D -0.9280
946 A D -1.6142
947 D D -2.9276
948 S D -2.2985
949 V D 0.0000
950 K D -2.9957
951 G D -2.4571
952 R D -3.2511
953 F D 0.0000
954 T D -1.4304
955 I D 0.0000
956 S D -0.5388
957 R D -1.1819
958 D D -1.6938
959 N D -1.9668
960 S D -1.6817
961 K D -2.4796
962 N D -1.8580
963 T D -1.0012
964 L D 0.0000
965 Y D -0.5395
966 L D 0.0000
967 Q D -1.6959
968 M D 0.0000
969 N D -2.4837
970 S D -2.2324
971 L D 0.0000
972 R D -3.3583
973 A D -2.1417
974 E D -2.5897
975 D D -1.7653
976 T D -0.9656
977 A D 0.0000
978 V D -0.1274
979 Y D 0.0000
980 Y D 0.0000
981 C D 0.0000
982 A D 0.0000
983 K D 0.0000
984 D D 0.1897
985 M D 0.6426
986 G D 1.0297
987 W D 1.4937
988 G D 0.8652
989 S D 0.2840
990 G D -0.1815
991 W D 0.4561
992 R D -0.9608
993 P D -0.1270
994 Y D 1.2219
995 Y D 0.8988
996 Y D 1.0769
997 Y D 1.0158
998 G D 0.0000
999 M D 0.0000
1000 D D -0.6504
1001 V D 0.0000
1002 W D 0.0000
1003 G D 0.0000
1004 Q D -1.1171
1005 G D -0.5509
1006 T D -0.2615
1007 T D -0.3216
1008 V D 0.0000
1009 T D -0.4453
1010 V D 0.0000
1011 S D -0.9859
1012 S D -0.7221
1013 A D -0.6008
1014 S D -0.7950
1015 T D -0.9897
1016 K D -1.6844
1017 G D -1.4793
1018 P D -0.6937
1019 S D -0.3929
1020 V D 0.0000
1021 F D -0.5315
1022 P D -1.1293
1023 L D 0.0000
1024 A D 0.0000
1025 P D -0.6365
1026 S D 0.0000
1027 S D -1.1695
1028 K D -1.9567
1029 S D -1.2389
1030 T D -0.9686
1031 S D -0.9056
1032 G D -0.7740
1033 G D -0.7035
1034 T D -0.5083
1035 A D -0.3278
1036 A D 0.0496
1037 L D 0.0000
1038 G D 0.0000
1039 C D 0.0000
1040 L D 0.0000
1041 V D 0.0000
1042 K D -0.3658
1043 D D -0.7128
1044 Y D 0.0000
1045 F D 0.0000
1046 P D 0.0000
1047 E D -1.3111
1048 P D -1.1689
1049 V D -0.8042
1050 T D -0.6314
1051 V D -0.2625
1052 S D -0.2805
1053 W D 0.0000
1054 N D -0.7863
1055 S D -0.6102
1056 G D -0.4248
1057 A D -0.1485
1058 L D 0.1592
1059 T D -0.0454
1060 S D -0.0706
1061 G D -0.1235
1062 V D 0.3838
1063 H D -0.1474
1064 T D 0.0997
1065 F D 0.0000
1066 P D -0.1475
1067 A D 0.2110
1068 V D 0.7011
1069 L D 1.1285
1070 Q D -0.4067
1071 S D -0.3340
1072 S D -0.4425
1073 G D -0.1961
1074 L D -0.0858
1075 Y D 0.1431
1076 S D 0.0000
1077 L D 0.1800
1078 S D 0.0000
1079 S D 0.0000
1080 V D 0.0000
1081 V D 0.0000
1082 T D -0.0417
1083 V D 0.0000
1084 P D -0.5545
1085 S D -0.5724
1086 S D -0.6684
1087 S D -0.7577
1088 L D -0.8916
1089 G D -1.1729
1090 T D -0.9116
1091 Q D -1.3471
1092 T D -1.3598
1093 Y D 0.0000
1094 I D -1.3442
1095 C D 0.0000
1096 N D -1.3682
1097 V D 0.0000
1098 N D -1.8304
1099 H D 0.0000
1100 K D -2.6913
1101 P D -1.7006
1102 S D -1.8828
1103 N D -2.3708
1104 T D -2.0184
1105 K D -2.4485
1106 V D -1.4384
1107 D D -1.9402
1108 K D -1.8647
1109 K D -2.6295
1110 V D 0.0000
1111 E D -2.6351
1112 P D -1.5394
1113 K D -1.2040
1114 S D -1.0769
1115 C D -0.7142
1116 D D -1.5889
1117 K D -1.9880
1118 T D -1.6597
1119 H D -1.7408
1120 T D -1.6839
1121 C D -1.3455
1122 P D -0.6675
1123 P D -0.3424
1124 C D -0.1140
1125 P D -0.5395
1126 A D -0.6848
1127 P D -0.7692
1128 E D -1.4111
1129 L D 0.1675
1130 L D 1.2617
1131 G D 0.0317
1132 G D 0.0109
1133 P D -0.0305
1134 S D 0.1936
1135 V D 0.0000
1136 F D 2.0370
1137 L D 1.6550
1138 F D 2.1085
1139 P D 0.4773
1140 P D 0.0000
1141 K D -1.8116
1142 P D -1.0840
1143 K D -0.8259
1144 D D 0.0000
1145 T D 0.0000
1146 L D 0.0000
1147 M D 0.8067
1148 I D 1.5422
1149 S D 0.0227
1150 R D -1.2105
1151 T D -0.6748
1152 P D 0.0000
1153 E D -1.1210
1154 V D 0.0000
1155 T D 0.9222
1156 C D 0.0000
1157 V D 0.9119
1158 V D 0.0000
1159 V D 0.3927
1160 D D -0.1725
1161 V D 0.0000
1162 S D -1.6409
1163 H D -2.2687
1164 E D -2.7714
1165 D D 0.0000
1166 P D -2.3694
1167 E D -2.9502
1168 V D 0.0000
1169 K D -2.5684
1170 F D 0.0000
1171 N D -1.1891
1172 W D 0.0000
1173 Y D -0.8090
1174 V D -0.7356
1175 D D -1.9488
1176 G D -0.5785
1177 V D 0.9951
1178 E D -0.0240
1179 V D 0.5409
1180 H D -1.0242
1181 N D -1.0634
1182 A D -1.1344
1183 K D -2.1124
1184 T D -1.5122
1185 K D -2.3410
1186 P D -2.1663
1187 R D -2.9479
1188 E D -2.9255
1189 E D -3.2343
1190 Q D -2.3732
1191 Y D -0.9174
1192 N D -0.6291
1193 S D -0.6180
1194 T D 0.0000
1195 Y D 0.0000
1196 R D -1.6502
1197 V D 0.0000
1198 V D -0.6135
1199 S D 0.0000
1200 V D -0.1074
1201 L D 0.0000
1202 T D -0.4587
1203 V D 0.3453
1204 L D 0.9801
1205 H D -0.0237
1206 Q D -0.9499
1207 D D -1.1099
1208 W D 0.0000
1209 L D -1.0893
1210 N D -2.0867
1211 G D -2.0204
1212 K D -2.3597
1213 E D -2.2400
1214 Y D 0.0000
1215 K D -1.5986
1216 C D 0.0000
1217 K D -1.5990
1218 V D 0.0000
1219 S D -1.4639
1220 N D -1.8602
1221 K D -2.0513
1222 A D -1.2481
1223 L D -0.5550
1224 P D -0.4837
1225 A D -0.3452
1226 P D -0.5196
1227 I D -0.4346
1228 E D -1.2990
1229 K D -0.9396
1230 T D -0.9187
1231 I D 0.1040
1232 S D -1.6591
1233 K D -1.7453
1234 A D -1.4651
1235 K D -2.4454
1236 G D -2.1574
1237 Q D -2.3517
1238 P D -2.2300
1239 R D -2.8075
1240 E D -2.7709
1241 P D 0.0000
1242 Q D -1.5904
1243 V D 0.0000
1244 Y D 0.0000
1245 T D 0.0000
1246 L D 0.0000
1247 P D -0.5203
1248 P D 0.0000
1249 S D -1.3494
1250 R D -2.6351
1251 D D -2.7892
1252 E D 0.0000
1253 L D -1.6439
1254 T D -1.7274
1255 K D -2.7329
1256 N D -2.8016
1257 Q D -2.7076
1258 V D 0.0000
1259 S D 0.0000
1260 L D 0.0000
1261 T D 0.0000
1262 C D 0.0000
1263 L D 0.0000
1264 V D 0.0000
1265 K D -0.7289
1266 G D -1.2248
1267 F D 0.0000
1268 Y D -1.3126
1269 P D 0.0000
1270 S D -0.1318
1271 D D -0.7711
1272 I D -0.3822
1273 A D -0.2525
1274 V D -0.3084
1275 E D -1.1914
1276 W D 0.0000
1277 E D -2.0460
1278 S D 0.0000
1279 N D -2.2818
1280 G D -1.9424
1281 Q D -2.3486
1282 P D -2.2012
1283 E D -2.5913
1284 N D -2.1989
1285 N D -1.5699
1286 Y D -0.9991
1287 K D -0.6834
1288 T D -0.3586
1289 T D 0.0000
1290 P D -0.0578
1291 P D 0.1758
1292 V D 0.5402
1293 L D 0.6276
1294 D D -0.5799
1295 S D -1.4108
1296 D D -1.9956
1297 G D -0.8612
1298 S D 0.0000
1299 F D 0.0572
1300 F D 0.0000
1301 L D 0.0000
1302 Y D 0.0000
1303 S D 0.0000
1304 K D 0.0000
1305 L D 0.0000
1306 T D -0.9236
1307 V D 0.0000
1308 D D -2.5139
1309 K D -2.5952
1310 S D -2.3282
1311 R D -3.0455
1312 W D 0.0000
1313 Q D -3.0369
1314 Q D -2.9331
1315 G D -2.3196
1316 N D -1.9551
1317 V D -1.2222
1318 F D 0.0000
1319 S D -1.1486
1320 C D 0.0000
1321 S D -0.7265
1322 V D 0.0000
1323 M D -0.3045
1324 H D 0.0000
1325 E D -1.0790
1326 A D -1.7659
1327 L D 0.0000
1328 H D -1.6791
1329 N D -1.6064
1330 H D -0.9486
1331 Y D -0.1767
1332 T D -0.9075
1333 Q D -1.2825
1334 K D -1.1539
1335 S D -0.6891
1336 L D 0.0000
1337 S D -1.1192
1338 L D 0.0000
1339 S D -1.4714
1340 P D -1.5452
1341 G D -2.3533
1342 K D -2.5929

 

Laboratory of Theory of Biopolymers 2015