Project name: DI1000160 chain S

Status: done

submitted: 2018-05-31 10:13:43, status changed: 2018-05-31 10:16:26
Settings
Chain sequence(s) S: FGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.4445
Maximal score value
1.4368
Average score
-0.4718
Total score value
-15.097

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
270 F S 1.4368
271 G S -0.0476
272 R S -1.1877
273 T S -0.4862
274 G S -0.4373
275 L S 0.4657
276 P S -0.5250
277 D S -1.7004
278 L S -1.3564
279 S S -0.7682
280 S S -0.9789
281 M S -1.0907
282 T S -1.8069
283 E S -2.4445
284 E S -2.3529
285 E S -1.6807
286 Q S -1.3536
287 I S 0.4864
288 A S 0.2202
289 Y S 0.7441
290 A S 0.6534
291 M S 1.2981
292 Q S 0.1493
293 M S 0.5676
294 S S 0.5088
295 L S -0.0907
296 Q S -1.2572
297 G S -0.8550
298 A S -0.6707
299 E S -1.1165
300 F S 0.8201
301 G S -0.2404

 

Laboratory of Theory of Biopolymers 2015