Project name: tev1

Status: done

submitted: 2017-03-13 07:48:04, status changed: 2017-03-13 07:54:00
Settings
Chain sequence(s) A: PRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKP
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.2051
Maximal score value
1.275
Average score
-0.7867
Total score value
-168.364

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
8 P A -1.3010
9 R A -2.5955
10 D A -2.7253
11 Y A -1.5035
12 N A -1.7761
13 P A -1.3585
14 I A 0.0000
15 S A 0.0000
16 S A -0.4467
17 T A 0.0000
18 I A 0.0000
19 C A 0.0000
20 H A -0.1663
21 L A 0.0000
22 T A -0.5930
23 N A 0.0000
24 E A -2.4635
25 S A 0.0000
26 D A -2.6502
27 G A -2.0405
28 H A -2.2785
29 T A -1.7376
30 T A 0.0000
31 S A -0.6412
32 L A 0.0000
33 Y A 0.0000
34 G A 0.0000
35 I A 0.0000
36 G A 0.0000
37 F A 0.0000
38 G A 0.0000
39 P A -1.0364
40 F A 0.0000
41 I A 0.0000
42 I A 0.0000
43 T A 0.0000
44 N A 0.0000
45 K A 0.0000
46 H A -0.6598
47 L A 0.0000
48 F A 0.0000
49 R A -1.8776
50 R A -2.9377
51 N A 0.0000
52 N A -2.6074
53 G A -2.3364
54 T A -1.9606
55 L A 0.0000
56 L A -0.4194
57 V A 0.0000
58 Q A 0.2543
59 S A 0.0000
60 L A 0.7272
61 H A -0.3367
62 G A 0.3944
63 V A 1.2750
64 F A -0.1916
65 K A -1.5340
66 V A 0.0000
67 K A -2.4990
68 N A -1.9458
69 T A 0.0000
70 T A -1.2085
71 T A -0.7906
72 L A 0.0000
73 Q A -0.9219
74 Q A 0.0000
75 H A 0.0000
76 L A -0.3297
77 I A 0.0000
78 D A -1.9570
79 G A -1.1919
80 R A -0.9067
81 D A 0.0000
82 M A 0.0000
83 I A 0.0000
84 I A 0.0000
85 I A 0.0000
86 R A -1.1040
87 M A 0.0000
88 P A -1.9390
89 K A -2.7581
90 D A -2.6805
91 F A 0.0000
92 P A -1.1874
93 P A -1.1259
94 F A 0.0000
95 P A -1.3475
96 Q A -2.3595
97 K A -2.6704
98 L A 0.0000
99 K A -1.7876
100 F A 0.0000
101 R A -1.2150
102 E A -1.5426
103 P A 0.0000
104 Q A -2.0604
105 R A -2.7967
106 E A -2.6851
107 E A 0.0000
108 R A -2.1036
109 I A 0.0000
110 C A 0.0000
111 L A 0.0000
112 V A 0.0000
113 T A 0.0000
114 T A 0.0000
115 N A -0.9620
116 F A -0.8620
117 Q A -1.7476
118 T A -1.3877
119 K A -2.0439
120 S A -1.3146
121 M A -0.4382
122 S A -0.2865
123 S A 0.0369
124 M A 0.5590
125 V A 0.1167
126 S A -0.6054
127 D A -1.8581
128 T A -0.9610
129 S A -0.3873
130 C A 0.0394
131 T A 0.0000
132 F A 0.6291
133 P A -0.1100
134 S A 0.0000
135 S A -1.0702
136 D A -1.9522
137 G A -0.8451
138 I A -0.8823
139 F A 0.0000
140 W A 0.0000
141 K A 0.3170
142 H A 0.0000
143 W A 0.0965
144 I A 0.0000
145 Q A -1.8516
146 T A -2.0611
147 K A -3.1700
148 D A -3.2051
149 G A -1.8267
150 Q A -1.7171
151 A A -0.8543
152 G A 0.0000
153 S A 0.0000
154 P A 0.0000
155 L A 0.0000
156 V A 0.0000
157 S A 0.0000
158 T A -1.7682
159 R A -2.4164
160 D A -1.5728
161 G A -1.2645
162 F A -0.5903
163 I A 0.0000
164 V A 0.0000
165 G A 0.0000
166 I A 0.0000
167 H A 0.0000
168 S A -0.2576
169 A A -0.6084
170 S A -0.8398
171 N A -0.1610
172 F A 0.8255
173 T A -0.1603
174 N A -1.4862
175 T A -0.6792
176 N A -0.6367
177 N A 0.0000
178 Y A 0.1311
179 F A 0.0000
180 T A 0.0000
181 S A 0.0000
182 V A 0.0000
183 P A -1.5303
184 K A -2.6688
185 N A -2.6596
186 F A 0.0000
187 M A -1.5374
188 E A -2.7368
189 L A -1.9859
190 L A 0.0000
191 T A -1.4583
192 N A -2.1361
193 Q A -2.7082
194 E A -2.9618
195 A A -2.1629
196 Q A -1.8018
197 Q A -1.4634
198 W A -0.4764
199 V A 0.1714
200 S A -0.1901
201 G A -0.7649
202 W A -0.7044
203 R A -1.8119
204 L A -1.6136
205 N A -2.0368
206 A A -1.5789
207 D A -1.7810
208 S A -0.6164
209 V A 0.1833
210 L A 0.9133
211 W A -0.1906
212 G A -0.7846
213 G A -0.9755
214 H A -0.6362
215 K A -0.9082
216 V A -0.3328
217 F A -0.0446
218 M A -0.5432
219 S A -1.0249
220 K A -1.4397
221 P A -0.6373

 

Laboratory of Theory of Biopolymers 2015