Project name: 48c0c03fcfbc487

Status: done

submitted: 2019-02-12 20:12:15, status changed: 2019-02-12 20:17:08
Settings
Chain sequence(s) A: LDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4541
Maximal score value
0.7942
Average score
-1.1671
Total score value
-103.8696

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
803 L A -0.4026
804 D A -1.3226
805 A A -0.7018
806 P A 0.0000
807 S A -0.5120
808 Q A -1.1852
809 I A -1.6395
810 E A -2.1355
811 V A -1.5929
812 K A -1.8409
813 D A -1.7926
814 V A -0.7845
815 T A -1.5420
816 D A -2.7634
817 T A -2.1512
818 T A -1.4756
819 A A 0.0000
820 L A -0.9390
821 I A 0.0000
822 T A 0.0000
823 W A 0.0000
824 F A 0.5342
825 K A -1.3790
826 P A 0.0000
827 L A 0.7942
828 A A -0.6252
829 E A -2.3562
830 I A 0.0000
831 D A -3.2988
832 G A 0.0000
833 I A 0.0000
834 E A -1.0409
835 L A 0.0000
836 T A -0.6855
837 Y A -0.5800
838 G A 0.0000
839 I A -1.1725
840 K A -1.7428
841 D A -1.8934
842 V A -0.3026
843 P A -0.8209
844 G A -1.0124
845 D A -1.1760
846 R A -1.1544
847 T A -0.4673
848 T A -0.5585
849 I A -0.5190
850 D A -2.0448
851 L A 0.0000
852 T A -2.2593
853 E A -3.4541
854 D A -3.3432
855 E A -2.6315
856 N A -2.0236
857 Q A -1.8085
858 Y A -0.5545
859 S A -0.5567
860 I A 0.0000
861 G A -1.4474
862 N A -2.1638
863 L A 0.0000
864 K A -3.1435
865 P A -3.0162
866 D A -3.1025
867 T A 0.0000
868 E A -2.7373
869 Y A 0.0000
870 E A -1.7700
871 V A 0.0000
872 S A 0.0000
873 L A 0.0000
874 I A -0.7085
875 S A 0.0000
876 R A -2.3875
877 R A -2.3572
878 G A -1.9967
879 D A -1.9987
880 M A -0.7731
881 S A -0.9967
882 S A 0.0000
883 N A -1.5708
884 P A -1.2429
885 A A -1.3449
886 K A -2.4545
887 E A -2.3981
888 T A -1.6955
889 F A 0.0000
890 T A -1.6316
891 T A -2.0177

 

Laboratory of Theory of Biopolymers 2015