Project name: GFPwt

Status: done

submitted: 2019-02-06 15:08:50, status changed: 2019-02-06 15:35:24
Settings
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
C: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
B: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
D: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.112
Maximal score value
1.3185
Average score
-0.9225
Total score value
-833.918

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 K A -2.4299
4 G A 0.0000
5 E A -2.3867
6 E A -2.4721
7 L A -0.8691
8 F A 0.0000
9 T A -0.3206
10 G A 0.4388
11 V A 1.3185
12 V A 0.0000
13 P A -0.9095
14 I A 0.0000
15 L A -0.6798
16 V A 0.0000
17 E A -1.4129
18 L A 0.0000
19 D A -3.2873
20 G A 0.0000
21 D A -2.8430
22 V A 0.0000
23 N A -2.1425
24 G A -1.7425
25 H A -2.2848
26 K A -3.0277
27 F A 0.0000
28 S A -1.7735
29 V A 0.0000
30 S A -0.6593
31 G A 0.0000
32 E A -1.3044
33 G A -1.1865
34 E A -1.0868
35 G A 0.0000
36 D A -0.1154
37 A A 0.0000
38 T A -0.0621
39 Y A -0.2777
40 G A 0.0000
41 K A -0.8367
42 L A 0.0000
43 T A -0.8328
44 L A 0.0000
45 K A -0.6842
46 F A 0.0000
47 I A -0.3506
48 C A 0.0000
49 T A -0.7328
50 T A -1.1634
51 G A -1.1962
52 K A -2.0050
53 L A 0.0000
54 P A -1.2375
55 V A 0.0000
56 P A -0.6069
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0009
63 T A 0.0000
64 L A 0.0000
68 V A -0.0137
69 Q A -0.1013
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -0.9764
74 Y A 0.0000
75 P A -1.7365
76 D A -2.7641
77 H A -2.1334
78 M A 0.0000
79 K A -2.7512
80 R A -2.8546
81 H A -1.7317
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.1942
87 A A 0.0000
88 M A 0.0000
89 P A -1.3649
90 E A -1.9642
91 G A 0.0000
92 Y A 0.0000
93 V A -0.6810
94 Q A 0.0000
95 E A -2.5859
96 R A 0.0000
97 T A -1.0125
98 I A 0.0000
99 S A -1.0224
100 F A 0.0000
101 K A -2.2518
102 D A -2.8212
103 D A -2.7936
104 G A 0.0000
105 N A -1.4876
106 Y A 0.0000
107 K A -2.5896
108 T A 0.0000
109 R A -3.3027
110 A A 0.0000
111 E A -1.8913
112 V A 0.0000
113 K A -1.1361
114 F A -1.0958
115 E A -1.1446
116 G A -1.5338
117 D A -1.9889
118 T A 0.0000
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -1.9403
123 I A 0.0000
124 E A -3.9429
125 L A 0.0000
126 K A -3.1587
127 G A 0.0000
128 I A -1.2694
129 D A -2.2874
130 F A 0.0000
131 K A -3.9594
132 E A -4.0025
133 D A -3.6587
134 G A -2.8714
135 N A -2.1907
136 I A 0.0000
137 L A -2.0632
138 G A -2.3966
139 H A -2.1441
140 K A -2.3777
141 L A -1.3187
142 E A -1.1759
143 Y A -0.3094
144 N A 0.0000
145 Y A 0.0000
146 N A 0.0000
147 S A 0.0000
148 H A 0.0000
149 N A -0.1223
150 V A 0.0000
151 Y A 0.3437
152 I A 0.0000
153 T A -1.2876
154 A A -1.8642
155 D A -2.3695
156 K A -3.2486
157 Q A -3.1476
158 K A -3.2696
159 N A -2.8538
160 G A 0.0000
161 I A 0.0000
162 K A -1.5264
163 A A 0.0000
164 N A -0.8977
165 F A 0.0000
166 K A -0.9790
167 I A 0.0000
168 R A -0.1785
169 H A 0.0000
170 N A -0.6405
171 I A 0.0000
172 E A -3.1232
173 D A -2.8827
174 G A -1.6954
175 S A -0.6133
176 V A 0.6248
177 Q A 0.0000
178 L A -0.3708
179 A A 0.0000
180 D A -0.7920
181 H A 0.0000
182 Y A -0.1912
183 Q A 0.0000
184 Q A -1.3997
185 N A 0.0000
186 T A -0.8427
187 P A -0.8652
188 I A -0.3315
189 G A -1.3229
190 D A -2.1535
191 G A -1.5479
192 P A -0.8301
193 V A -0.1227
194 L A -0.2382
195 L A -0.6559
196 P A 0.0000
197 D A -2.4906
198 N A -1.8724
199 H A 0.0000
200 Y A -0.0272
201 L A 0.0000
202 S A 0.0113
203 T A -0.1576
204 Q A 0.0000
205 S A -0.2178
206 A A 0.0000
207 L A 0.0000
208 S A -0.2906
209 K A -1.0711
210 D A -1.2889
211 P A -1.3035
212 N A -2.2686
213 E A -2.0761
214 K A -2.3106
215 R A -1.6277
216 D A -1.4728
217 H A 0.0000
218 M A 0.0000
219 V A -0.1209
220 L A 0.0000
221 L A 0.0000
222 E A -0.5418
223 F A 0.0000
224 V A 0.0000
225 T A -0.3725
226 A A 0.0000
227 A A -0.2185
228 G A -0.6685
229 I A -0.7347
230 T A -0.5701
231 H A -1.3114
3 K B -2.4380
4 G B 0.0000
5 E B -2.4249
6 E B -2.4557
7 L B -1.0899
8 F B 0.0000
9 T B -0.9376
10 G B 0.0000
11 V B 0.3788
12 V B 0.0000
13 P B -1.0754
14 I B 0.0000
15 L B -1.1682
16 V B 0.0000
17 E B -1.9387
18 L B 0.0000
19 D B -3.3068
20 G B 0.0000
21 D B -2.5811
22 V B 0.0000
23 N B -2.0265
24 G B -1.7105
25 H B -2.2831
26 K B -2.9485
27 F B 0.0000
28 S B -1.6184
29 V B 0.0000
30 S B -1.1527
31 G B 0.0000
32 E B -2.4084
33 G B -1.8008
34 E B -1.6392
35 G B 0.0000
36 D B -0.1932
37 A B 0.0000
38 T B -0.0017
39 Y B -0.1991
40 G B 0.0000
41 K B -0.7675
42 L B 0.0000
43 T B -1.0493
44 L B 0.0000
45 K B -1.4956
46 F B 0.0000
47 I B 0.0000
48 C B 0.0000
49 T B -0.7892
50 T B -1.1737
51 G B -1.6919
52 K B -2.2756
53 L B 0.0000
54 P B -1.1836
55 V B 0.0000
56 P B 0.0000
57 W B 0.0000
58 P B 0.0000
59 T B 0.0000
60 L B 0.0000
61 V B 0.1771
62 T B 0.0889
63 T B 0.0000
64 L B 0.0000
68 V B -0.0346
69 Q B -0.1588
70 C B 0.0000
71 F B 0.0000
72 S B 0.0000
73 R B -0.8849
74 Y B 0.0000
75 P B -1.8165
76 D B -2.9411
77 H B -2.2388
78 M B 0.0000
79 K B -3.3332
80 R B -3.0529
81 H B -2.1644
82 D B 0.0000
83 F B 0.0000
84 F B 0.0000
85 K B 0.0000
86 S B -1.3148
87 A B 0.0000
88 M B 0.0000
89 P B -1.7065
90 E B -2.3302
91 G B 0.0000
92 Y B 0.0000
93 V B 0.0000
94 Q B 0.0000
95 E B -1.8140
96 R B 0.0000
97 T B -1.2981
98 I B 0.0000
99 S B -1.9152
100 F B 0.0000
101 K B -2.9032
102 D B -3.0747
103 D B -2.8042
104 G B 0.0000
105 N B -1.7942
106 Y B 0.0000
107 K B -2.7214
108 T B 0.0000
109 R B -3.0049
110 A B 0.0000
111 E B -2.0610
112 V B 0.0000
113 K B -1.5939
114 F B -1.6703
115 E B -1.9716
116 G B -1.8734
117 D B -2.2229
118 T B -1.5771
119 L B 0.0000
120 V B 0.0000
121 N B 0.0000
122 R B -2.3927
123 I B 0.0000
124 E B -3.9547
125 L B 0.0000
126 K B -3.2933
127 G B 0.0000
128 I B -1.0382
129 D B -2.1673
130 F B 0.0000
131 K B -3.9010
132 E B -3.8707
133 D B -3.4875
134 G B 0.0000
135 N B -2.1751
136 I B 0.0000
137 L B -1.7514
138 G B -2.0534
139 H B -1.6129
140 K B -2.2374
141 L B -1.3520
142 E B -1.2288
143 Y B -0.3228
144 N B 0.0000
145 Y B 0.0000
146 N B 0.0000
147 S B 0.0000
148 H B 0.0000
149 N B -0.2980
150 V B 0.0000
151 Y B 0.5739
152 I B 0.0000
153 T B -1.1344
154 A B -1.7112
155 D B 0.0000
156 K B -3.0563
157 Q B -3.1608
158 K B -3.3380
159 N B -2.8432
160 G B 0.0000
161 I B 0.0000
162 K B -0.8824
163 A B 0.0000
164 N B -1.2987
165 F B -1.1689
166 K B -2.1748
167 I B 0.0000
168 R B -0.5996
169 H B 0.0000
170 N B -0.7763
171 I B 0.0000
172 E B -3.1224
173 D B -2.9837
174 G B -1.8358
175 S B -0.8110
176 V B 0.0404
177 Q B 0.0000
178 L B -1.1528
179 A B 0.0000
180 D B -2.6997
181 H B 0.0000
182 Y B -0.7805
183 Q B 0.0000
184 Q B -1.0610
185 N B 0.0000
186 T B -0.7624
187 P B -0.9583
188 I B -0.4120
189 G B -1.3294
190 D B -2.2297
191 G B -1.5582
192 P B -0.8562
193 V B -0.4012
194 L B -0.4269
195 L B -0.7587
196 P B 0.0000
197 D B -2.5339
198 N B -1.8480
199 H B 0.0000
200 Y B 0.0299
201 L B 0.0000
202 S B -0.0161
203 T B -0.2593
204 Q B 0.0000
205 S B 0.0000
206 A B 0.0000
207 L B 0.0000
208 S B -0.4273
209 K B -1.3652
210 D B -1.5761
211 P B -1.4868
212 N B -2.2447
213 E B -2.4847
214 K B -3.0989
215 R B -3.0673
216 D B -2.2306
217 H B 0.0000
218 M B 0.0000
219 V B -0.3275
220 L B 0.0000
221 L B -0.1594
222 E B -0.3887
223 F B 0.0000
224 V B 0.0000
225 T B -0.3236
226 A B 0.0000
227 A B -0.1835
228 G B -0.5352
229 I B -0.6403
230 T B -0.5466
231 H B -1.2625
3 K C -2.4431
4 G C 0.0000
5 E C -2.4209
6 E C -2.4707
7 L C -1.0291
8 F C 0.0000
9 T C -0.4165
10 G C 0.3318
11 V C 1.1821
12 V C 0.0000
13 P C -1.0274
14 I C 0.0000
15 L C -1.1485
16 V C 0.0000
17 E C -1.9546
18 L C 0.0000
19 D C -3.4112
20 G C 0.0000
21 D C -2.7791
22 V C 0.0000
23 N C -2.3687
24 G C -1.8750
25 H C -2.4747
26 K C -3.0181
27 F C 0.0000
28 S C -1.6672
29 V C 0.0000
30 S C -1.1108
31 G C 0.0000
32 E C -2.0970
33 G C -1.4900
34 E C -1.4897
35 G C 0.0000
36 D C -0.0465
37 A C 0.0000
38 T C 0.0415
39 Y C -0.1245
40 G C 0.0000
41 K C -0.7002
42 L C 0.0000
43 T C -1.0604
44 L C 0.0000
45 K C -1.5663
46 F C 0.0000
47 I C 0.0000
48 C C 0.0000
49 T C -0.9421
50 T C -1.3884
51 G C -1.5698
52 K C -1.9028
53 L C -1.2297
54 P C -1.1619
55 V C 0.0000
56 P C 0.0000
57 W C 0.0000
58 P C 0.0000
59 T C 0.0000
60 L C 0.0000
61 V C 0.0000
62 T C 0.0064
63 T C 0.0000
64 L C 0.0000
68 V C 0.0451
69 Q C -0.0379
70 C C 0.0000
71 F C 0.0000
72 S C 0.0000
73 R C -0.7011
74 Y C 0.0000
75 P C -1.7491
76 D C -2.6802
77 H C -2.1175
78 M C 0.0000
79 K C -2.8739
80 R C -2.9029
81 H C -1.7775
82 D C 0.0000
83 F C 0.0000
84 F C 0.0000
85 K C 0.0000
86 S C -1.1269
87 A C -1.0727
88 M C 0.0000
89 P C -1.9890
90 E C -2.5986
91 G C 0.0000
92 Y C 0.0000
93 V C -0.8979
94 Q C -1.5044
95 E C -2.2303
96 R C 0.0000
97 T C -0.9290
98 I C 0.0000
99 S C -1.1982
100 F C 0.0000
101 K C -2.2921
102 D C -2.8741
103 D C -2.8156
104 G C 0.0000
105 N C -1.4005
106 Y C 0.0000
107 K C -2.0497
108 T C 0.0000
109 R C -3.4452
110 A C 0.0000
111 E C -2.3167
112 V C 0.0000
113 K C -1.8282
114 F C 0.0000
115 E C -2.8341
116 G C -2.3355
117 D C -2.4868
118 T C -1.6758
119 L C 0.0000
120 V C 0.0000
121 N C 0.0000
122 R C -3.1815
123 I C 0.0000
124 E C -4.1120
125 L C 0.0000
126 K C -2.8522
127 G C 0.0000
128 I C -1.1655
129 D C -2.3274
130 F C 0.0000
131 K C -3.9590
132 E C -3.9068
133 D C -3.5825
134 G C -2.8039
135 N C -2.1960
136 I C 0.0000
137 L C -1.9298
138 G C -2.2441
139 H C -1.9250
140 K C -2.4225
141 L C 0.0000
142 E C -1.2979
143 Y C -0.2936
144 N C 0.0000
145 Y C 0.0000
146 N C 0.0000
147 S C 0.0000
148 H C 0.0000
149 N C -0.2210
150 V C 0.0000
151 Y C 0.3345
152 I C 0.0000
153 T C -1.1021
154 A C -1.6276
155 D C -2.1499
156 K C -3.1157
157 Q C -3.2012
158 K C -3.1931
159 N C -2.8952
160 G C 0.0000
161 I C 0.0000
162 K C -0.8591
163 A C 0.0000
164 N C -1.1479
165 F C 0.0000
166 K C -1.4028
167 I C 0.0000
168 R C -0.9510
169 H C 0.0000
170 N C -0.8863
171 I C 0.0000
172 E C -3.1332
173 D C -2.9312
174 G C -1.7945
175 S C -0.7984
176 V C 0.1391
177 Q C 0.0000
178 L C -0.8981
179 A C 0.0000
180 D C -1.4403
181 H C 0.0000
182 Y C -0.4420
183 Q C 0.0000
184 Q C -1.1443
185 N C 0.0000
186 T C -0.9743
187 P C -0.9920
188 I C -0.5543
189 G C -1.4931
190 D C -2.2262
191 G C -1.8179
192 P C -0.9908
193 V C -0.4953
194 L C -0.2452
195 L C -0.5586
196 P C 0.0000
197 D C -2.4737
198 N C -1.8605
199 H C 0.0000
200 Y C -0.0478
201 L C 0.0000
202 S C -0.0272
203 T C -0.2252
204 Q C 0.0000
205 S C 0.0000
206 A C 0.0000
207 L C 0.0000
208 S C 0.0000
209 K C -1.3052
210 D C -1.5088
211 P C -1.4077
212 N C -2.2266
213 E C -2.1308
214 K C -2.4838
215 R C -2.1584
216 D C -1.4795
217 H C 0.0000
218 M C 0.0000
219 V C -0.4121
220 L C 0.0000
221 L C -0.2054
222 E C -0.4255
223 F C 0.0000
224 V C 0.0000
225 T C -0.2825
226 A C 0.0000
227 A C -0.1954
228 G C -0.6782
229 I C -0.6582
230 T C -0.5403
231 H C -1.0858
3 K D -2.5351
4 G D 0.0000
5 E D -2.4622
6 E D -2.5687
7 L D -0.9771
8 F D 0.0000
9 T D -0.4167
10 G D 0.4097
11 V D 1.2218
12 V D 0.0000
13 P D -1.0386
14 I D 0.0000
15 L D -1.1539
16 V D 0.0000
17 E D -1.8333
18 L D 0.0000
19 D D -3.3452
20 G D 0.0000
21 D D -2.7935
22 V D 0.0000
23 N D -2.0596
24 G D -1.6761
25 H D -2.3435
26 K D -3.0446
27 F D 0.0000
28 S D -1.7375
29 V D 0.0000
30 S D -1.0104
31 G D 0.0000
32 E D -2.4178
33 G D -1.9677
34 E D -1.7490
35 G D 0.0000
36 D D -0.0695
37 A D 0.0000
38 T D 0.0003
39 Y D -0.1885
40 G D 0.0000
41 K D -0.5651
42 L D 0.0000
43 T D -1.0798
44 L D 0.0000
45 K D -1.4733
46 F D 0.0000
47 I D -0.8950
48 C D 0.0000
49 T D -0.7348
50 T D -1.1424
51 G D -1.6771
52 K D -2.2797
53 L D 0.0000
54 P D -1.2666
55 V D 0.0000
56 P D 0.0000
57 W D 0.0000
58 P D 0.0000
59 T D 0.0000
60 L D 0.0000
61 V D 0.0000
62 T D -0.0057
63 T D 0.0000
64 L D 0.0000
68 V D -0.0148
69 Q D -0.1069
70 C D 0.0000
71 F D 0.0000
72 S D 0.0000
73 R D -0.9045
74 Y D 0.0000
75 P D -1.7888
76 D D -2.8741
77 H D -2.2951
78 M D 0.0000
79 K D -2.9644
80 R D -2.8907
81 H D -1.8798
82 D D 0.0000
83 F D 0.0000
84 F D 0.0000
85 K D 0.0000
86 S D -1.3395
87 A D 0.0000
88 M D 0.0000
89 P D -1.4578
90 E D -2.3244
91 G D 0.0000
92 Y D 0.0000
93 V D -0.7127
94 Q D 0.0000
95 E D -2.1028
96 R D 0.0000
97 T D -0.9339
98 I D 0.0000
99 S D -1.3329
100 F D 0.0000
101 K D -2.6082
102 D D -3.1818
103 D D -2.7666
104 G D 0.0000
105 N D -1.3795
106 Y D 0.0000
107 K D -2.0031
108 T D 0.0000
109 R D -3.4480
110 A D 0.0000
111 E D -2.1107
112 V D 0.0000
113 K D -1.4752
114 F D -1.4610
115 E D -1.7409
116 G D -1.7633
117 D D -2.1312
118 T D -1.4098
119 L D 0.0000
120 V D 0.0000
121 N D 0.0000
122 R D -2.4777
123 I D 0.0000
124 E D -4.0357
125 L D 0.0000
126 K D -2.8239
127 G D 0.0000
128 I D -1.0622
129 D D -2.4357
130 F D 0.0000
131 K D -3.8751
132 E D -3.8407
133 D D -3.4944
134 G D 0.0000
135 N D -2.0953
136 I D 0.0000
137 L D -1.8272
138 G D -2.1839
139 H D -1.7799
140 K D -2.2526
141 L D -1.2877
142 E D -1.0799
143 Y D -0.1554
144 N D 0.0000
145 Y D 0.0000
146 N D 0.0000
147 S D -0.3654
148 H D -0.4655
149 N D -0.4208
150 V D 0.0000
151 Y D 0.5170
152 I D 0.0000
153 T D -1.2130
154 A D -1.7769
155 D D -2.1180
156 K D -3.0347
157 Q D -2.8904
158 K D -2.8168
159 N D -2.5865
160 G D 0.0000
161 I D 0.0000
162 K D -1.0953
163 A D 0.0000
164 N D -1.1451
165 F D 0.0000
166 K D -1.8027
167 I D 0.0000
168 R D -1.6112
169 H D 0.0000
170 N D -1.0819
171 I D 0.0000
172 E D -3.0891
173 D D -2.9595
174 G D -1.8617
175 S D -1.0133
176 V D -0.4258
177 Q D 0.0000
178 L D -1.3091
179 A D 0.0000
180 D D -1.6863
181 H D 0.0000
182 Y D -0.5377
183 Q D 0.0000
184 Q D -1.1407
185 N D 0.0000
186 T D -0.5822
187 P D -0.8376
188 I D -0.3980
189 G D -1.4226
190 D D -2.2801
191 G D -1.5789
192 P D -0.8549
193 V D -0.4197
194 L D -0.5948
195 L D -0.8784
196 P D 0.0000
197 D D -2.5283
198 N D -1.8463
199 H D 0.0000
200 Y D 0.0473
201 L D 0.0000
202 S D 0.0252
203 T D -0.1560
204 Q D 0.0000
205 S D -0.0921
206 A D 0.0000
207 L D 0.0000
208 S D -0.4034
209 K D -1.2434
210 D D -1.6635
211 P D -1.3635
212 N D -2.2701
213 E D -2.5473
214 K D -3.2617
215 R D -3.3676
216 D D -2.2193
217 H D 0.0000
218 M D 0.0000
219 V D -0.2731
220 L D 0.0000
221 L D -0.0166
222 E D -0.2357
223 F D -0.2448
224 V D 0.0000
225 T D -0.2848
226 A D 0.0000
227 A D -0.2863
228 G D -0.8198
229 I D -0.6581
230 T D -0.5663
231 H D -1.3377

 

Laboratory of Theory of Biopolymers 2015