Project name: 53d94483359f79f

Status: done

submitted: 2017-09-14 12:41:57, status changed: 2017-09-14 12:50:13
Settings
Chain sequence(s) A: YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV
C: QVYPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSVGR
B: VYPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSVGR
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4375
Maximal score value
1.7859
Average score
-0.8417
Total score value
-301.3301

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
863 Y A 1.3079
864 P A 0.7203
865 I A 0.0000
866 G A 0.0000
867 T A 0.0000
868 E A -1.7752
869 K A -2.9951
870 E A -3.1065
871 P A -2.2160
872 N A 0.0000
873 N A -2.1130
874 S A -1.4495
875 K A -1.8461
876 E A -2.1862
877 T A -1.8228
878 A A -1.4145
879 S A 0.0000
880 G A -0.1254
881 P A 0.1802
882 I A 0.0000
883 V A 0.0654
884 P A -0.8501
885 G A -1.0167
886 I A -0.5287
887 P A -0.6046
888 V A 0.0000
889 S A 0.0000
890 G A 0.0000
891 T A -0.6860
892 I A 0.0000
893 E A -1.7446
894 N A -1.2153
895 T A -0.4134
896 S A -0.8228
897 D A -1.5986
898 Q A -1.1655
899 D A 0.0000
900 Y A -1.0257
901 F A 0.0000
902 Y A -0.2570
903 F A 0.0000
904 D A -0.1823
905 V A 0.0000
906 I A 1.4523
907 T A 0.0022
908 P A -1.6022
909 G A -1.7795
910 E A -3.1466
911 V A 0.0000
912 K A -3.0035
913 I A 0.0000
914 D A -1.7364
915 I A 0.0000
916 N A -1.0233
917 K A 0.0000
918 L A 0.0000
919 G A 0.0000
920 Y A 0.2013
921 G A 0.0000
922 G A 0.0000
923 A A 0.0000
924 T A 0.1985
925 W A 0.0000
926 V A 0.0000
927 V A 0.0000
928 Y A -1.1813
929 D A -2.4456
930 E A -3.3878
931 N A -3.2952
932 N A -3.0217
933 N A -2.4470
934 A A -0.6916
935 V A -0.0452
936 S A 0.0000
937 Y A 0.9899
938 A A -0.4572
939 T A -1.4375
940 D A -2.9911
941 D A -3.1710
942 G A -2.2549
943 Q A -1.8723
944 N A -2.0321
945 L A 0.0000
946 S A -1.5575
947 G A -1.1877
948 K A -2.7269
949 F A -1.9924
950 K A -3.3264
951 A A 0.0000
952 D A -3.3918
953 K A -2.7573
954 P A -1.1765
955 G A -1.4700
956 R A -1.5210
957 Y A 0.0000
958 Y A -0.7266
959 I A 0.0000
960 H A -0.0076
961 L A 0.0000
962 Y A 0.2505
963 M A 0.0000
964 F A 1.3660
965 N A 0.0147
966 G A -0.0738
967 S A -0.2201
968 Y A 0.0326
969 M A 0.0000
970 P A -0.3885
971 Y A 0.0000
972 R A -0.6274
973 I A 0.0000
974 N A -1.3061
975 I A 0.0000
976 E A -2.7811
977 G A -2.1010
978 S A -0.8418
979 V A -0.0247
862 V B 1.7859
863 Y B 0.6340
864 P B 0.3442
865 I B 0.0000
866 G B 0.0000
867 T B -1.1966
868 E B -1.6657
869 K B -2.8382
870 E B -3.0665
871 P B -2.1832
872 N B 0.0000
873 N B -2.0252
874 S B -1.3409
875 K B -1.5098
876 E B -2.0960
877 T B -1.7697
878 A B -1.3899
879 S B 0.0000
880 G B -0.0432
881 P B -0.0078
882 I B 0.0000
883 V B 0.0000
884 P B 0.0000
885 G B -0.6177
886 I B 0.0000
887 P B -0.7089
888 V B 0.0000
889 S B -1.0849
890 G B -1.0537
891 T B -0.7683
892 I B 0.0000
893 E B -1.8318
894 N B -1.1201
895 T B -0.4808
896 S B -0.7782
897 D B -1.4632
898 Q B -1.3337
899 D B 0.0000
900 Y B -0.9400
901 F B 0.0000
902 Y B -0.1336
903 F B 0.0000
904 D B 0.0000
905 V B 0.0000
906 I B -0.5324
907 T B 0.0000
908 P B -1.5453
909 G B -1.7546
910 E B -2.7342
911 V B 0.0000
912 K B -2.5004
913 I B 0.0000
914 D B -1.4784
915 I B 0.0000
916 N B -1.2620
917 K B 0.0000
918 L B 0.7396
919 G B 0.9624
920 Y B 1.2342
921 G B 0.5766
922 G B 0.0357
923 A B 0.0000
924 T B 0.2091
925 W B 0.0000
926 V B 0.0000
927 V B 0.0000
928 Y B -1.1329
929 D B -2.2373
930 E B -3.3571
931 N B -3.2890
932 N B -3.0489
933 N B -2.5192
934 A B -0.6928
935 V B -0.0762
936 S B 0.0000
937 Y B 0.9791
938 A B -0.4085
939 T B -1.4156
940 D B -3.0266
941 D B -3.3241
942 G B -2.5833
943 Q B -2.1489
944 N B -2.2290
945 L B 0.0000
946 S B -1.5731
947 G B -1.1043
948 K B -2.5178
949 F B 0.0000
950 K B -3.1635
951 A B 0.0000
952 D B -3.2606
953 K B -2.9238
954 P B -1.6340
955 G B -1.6311
956 R B -1.4560
957 Y B 0.0000
958 Y B -0.6337
959 I B 0.0000
960 H B 0.0123
961 L B 0.0000
962 Y B 0.0246
963 M B 0.0000
964 F B 1.0880
965 N B -0.2958
966 G B -0.2928
967 S B -0.1063
968 Y B 0.4770
969 M B 0.0000
970 P B 0.1293
971 Y B 0.0000
972 R B -1.0821
973 I B 0.0000
974 N B -1.1126
975 I B 0.0000
976 E B -1.6885
977 G B -1.6578
978 S B 0.0000
979 V B 0.0000
980 G B 0.0000
981 R B -1.5489
861 Q C -0.3314
862 V C 1.0994
863 Y C 0.8788
864 P C 0.5605
865 I C 0.0000
866 G C -0.4133
867 T C -1.0128
868 E C -1.7025
869 K C -2.7363
870 E C -3.0078
871 P C -2.1359
872 N C 0.0000
873 N C -2.0876
874 S C -1.5348
875 K C -2.0574
876 E C -2.2859
877 T C -1.8456
878 A C -1.4830
879 S C 0.0000
880 G C 0.0000
881 P C 0.0000
882 I C 0.0000
883 V C 0.0000
884 P C -0.9354
885 G C -0.3864
886 I C 0.4507
887 P C -0.2915
888 V C 0.0000
889 S C -0.7522
890 G C -0.9410
891 T C -0.4838
892 I C 0.0000
893 E C -1.7749
894 N C -1.2935
895 T C -0.5701
896 S C -0.7743
897 D C -1.5137
898 Q C -1.3934
899 D C 0.0000
900 Y C -1.0463
901 F C 0.0000
902 Y C -0.4010
903 F C 0.0000
904 D C -0.8713
905 V C 0.0000
906 I C 0.0000
907 T C 0.0000
908 P C -1.9732
909 G C -2.2435
910 E C -3.1033
911 V C 0.0000
912 K C -2.9735
913 I C 0.0000
914 D C -2.0886
915 I C 0.0000
916 N C -1.4279
917 K C -0.8290
918 L C 0.4855
919 G C 0.7038
920 Y C 0.9615
921 G C 0.3369
922 G C -0.1598
923 A C 0.0000
924 T C 0.1491
925 W C 0.0000
926 V C 0.0000
927 V C 0.0000
928 Y C -1.1821
929 D C -2.1580
930 E C -3.0867
931 N C -3.0838
932 N C -2.9573
933 N C -2.4072
934 A C -0.6742
935 V C -0.1038
936 S C 0.0000
937 Y C 0.9700
938 A C -0.4912
939 T C -1.4922
940 D C -3.2560
941 D C -3.4375
942 G C -2.5676
943 Q C -2.4764
944 N C -2.6489
945 L C 0.0000
946 S C -1.7304
947 G C -1.1618
948 K C -2.7578
949 F C 0.0000
950 K C -3.2763
951 A C 0.0000
952 D C -3.2170
953 K C -2.9173
954 P C -1.6331
955 G C -1.7564
956 R C -1.8245
957 Y C 0.0000
958 Y C 0.0000
959 I C 0.0000
960 H C -0.0729
961 L C 0.0000
962 Y C 0.0336
963 M C 0.0000
964 F C 1.1347
965 N C -0.5084
966 G C -0.5856
967 S C -0.4556
968 Y C 0.4180
969 M C 0.0000
970 P C 0.0805
971 Y C 0.0000
972 R C -1.2512
973 I C 0.0000
974 N C -1.2948
975 I C 0.0000
976 E C -2.7587
977 G C -2.0054
978 S C -1.0459
979 V C 0.0000
980 G C -0.7895
981 R C -0.8617

 

Laboratory of Theory of Biopolymers 2015