Project name: 5402603266c8ad0

Status: done

submitted: 2019-01-11 12:57:19, status changed: 2019-01-11 13:26:00
Settings
Chain sequence(s) A: ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
B: ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9232
Maximal score value
1.0446
Average score
-0.8569
Total score value
-392.461

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -1.1406
2 S A -1.5801
3 K A -2.1386
4 G A 0.0000
5 E A -1.5868
6 E A -2.1640
7 L A -0.7832
8 F A 0.0000
9 T A -0.3742
10 G A 0.2457
11 V A 1.0446
12 V A 0.0000
13 P A -1.0750
14 I A 0.0000
15 L A -1.1390
16 V A 0.0000
17 E A -1.9696
18 L A 0.0000
19 D A -3.2345
20 G A -2.6860
21 D A -2.2589
22 V A 0.0000
23 N A -1.7468
24 G A -1.3012
25 H A -1.7547
26 K A -2.6609
27 F A 0.0000
28 S A -1.7810
29 V A 0.0000
30 S A -1.1036
31 G A 0.0000
32 E A -2.4192
33 G A -1.7361
34 E A -1.8144
35 G A 0.0000
36 D A -0.3114
37 A A 0.0000
38 T A -0.1221
39 Y A -0.3369
40 G A 0.0000
41 K A -0.6529
42 L A 0.0000
43 T A -1.0913
44 L A 0.0000
45 K A -1.5330
46 F A 0.0000
47 I A -1.2185
48 C A 0.0000
49 T A -0.7477
50 T A -1.1625
51 G A -1.6617
52 K A -2.2851
53 L A 0.0000
54 P A -1.1286
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A 0.0000
63 T A 0.0000
64 F A 0.0000
66 Y A 0.0000
67 G A 0.0000
68 V A 0.0000
69 Q A 0.0000
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -0.6722
74 Y A 0.0000
75 P A -1.6458
76 D A -2.7603
77 H A -2.3580
78 M A 0.0000
79 K A -2.3440
80 R A -2.7300
81 H A -1.6816
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -0.9731
87 A A 0.0000
88 M A 0.0000
89 P A -1.0116
90 E A -1.5956
91 G A 0.0000
92 Y A 0.0000
93 V A -0.6322
94 Q A 0.0000
95 E A -2.3598
96 R A 0.0000
97 T A -0.4757
98 I A 0.0000
99 F A 0.2701
100 F A 0.0000
101 K A -2.1955
102 D A -2.9594
103 D A -2.6030
104 G A 0.0000
105 N A -0.6977
106 Y A 0.0000
107 K A -1.6372
108 T A 0.0000
109 R A -3.2618
110 A A 0.0000
111 E A -1.7787
112 V A 0.0000
113 K A -1.1616
114 F A -1.2838
115 E A -1.5841
116 G A -1.7118
117 D A -2.1363
118 T A -1.6119
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.2695
123 I A 0.0000
124 E A -3.8366
125 L A 0.0000
126 K A -2.2184
127 G A 0.0000
128 I A -1.0944
129 D A -2.4720
130 F A 0.0000
131 K A -3.7750
132 E A -3.8652
133 D A -3.5290
134 G A -2.7794
135 N A -2.2212
136 I A 0.0000
137 L A -1.9515
138 G A -2.2760
139 H A -2.0927
140 K A -2.3370
141 L A 0.0000
142 E A -1.2538
143 Y A -0.3129
144 N A 0.0000
145 Y A 0.0000
146 N A 0.0000
147 S A 0.0000
148 H A 0.0000
149 N A -0.3536
150 V A 0.0000
151 Y A 0.2663
152 I A 0.0000
153 M A -0.8487
154 A A -1.7834
155 D A -2.3686
156 K A -3.2489
157 Q A -3.1938
158 K A -3.4002
159 N A -2.7522
160 G A 0.0000
161 I A 0.0000
162 K A -1.1910
163 V A 0.0000
164 N A -0.3270
165 F A 0.0000
166 K A -1.3817
167 I A 0.0000
168 R A -0.6807
169 H A 0.0000
170 N A -0.8572
171 I A 0.0000
172 E A -3.1398
173 D A -2.9623
174 G A -1.8590
175 S A -0.7872
176 V A 0.0110
177 Q A 0.0000
178 L A -0.6659
179 A A 0.0000
180 D A -0.6747
181 H A 0.0000
182 Y A -0.0575
183 Q A 0.0000
184 Q A -1.2776
185 N A 0.0000
186 T A -0.7511
187 P A -0.6360
188 I A 0.0001
189 G A -1.0814
190 D A -1.9767
191 G A -1.2607
192 P A -0.7501
193 V A -0.4359
194 L A -0.4241
195 L A -0.9022
196 P A 0.0000
197 D A -2.3770
198 N A -1.6349
199 H A 0.0000
200 Y A -0.0154
201 L A 0.0000
202 S A -0.0838
203 T A 0.0000
204 Q A 0.0000
205 S A 0.0000
206 A A 0.0000
207 L A 0.0000
208 S A -0.5786
209 K A -1.5163
210 D A -1.7378
211 P A -1.5516
212 N A -2.2814
213 E A -2.5579
214 K A -3.1251
215 R A -3.1556
216 D A -2.1307
217 H A 0.0000
218 M A 0.0000
219 V A 0.0000
220 L A 0.0000
221 L A -0.0406
222 E A 0.0000
223 F A 0.0000
224 V A 0.0000
225 T A -0.1952
226 A A 0.0000
227 A A -0.2016
228 G A -0.5892
229 I A -0.6059
230 T A -0.2060
1 A B -1.1729
2 S B -1.6155
3 K B -2.2100
4 G B 0.0000
5 E B -1.6895
6 E B -2.2366
7 L B -0.8378
8 F B 0.0000
9 T B -0.3895
10 G B 0.2048
11 V B 1.0265
12 V B 0.0000
13 P B -1.0960
14 I B 0.0000
15 L B -1.1443
16 V B 0.0000
17 E B -1.9479
18 L B 0.0000
19 D B -3.1843
20 G B 0.0000
21 D B -2.1783
22 V B 0.0000
23 N B -1.7251
24 G B -1.2947
25 H B -1.7561
26 K B -2.6717
27 F B 0.0000
28 S B -1.7447
29 V B 0.0000
30 S B -1.0812
31 G B 0.0000
32 E B -2.4393
33 G B -1.7836
34 E B -1.8461
35 G B 0.0000
36 D B -0.3222
37 A B 0.0000
38 T B -0.1946
39 Y B -0.4908
40 G B 0.0000
41 K B -0.7850
42 L B 0.0000
43 T B -1.1161
44 L B 0.0000
45 K B -1.5076
46 F B 0.0000
47 I B -1.2335
48 C B 0.0000
49 T B -0.7845
50 T B -1.1986
51 G B -1.7294
52 K B -2.3471
53 L B 0.0000
54 P B -1.1833
55 V B 0.0000
56 P B 0.0000
57 W B 0.0000
58 P B 0.0000
59 T B 0.0000
60 L B 0.0000
61 V B 0.0000
62 T B 0.0000
63 T B 0.0000
64 F B 0.0000
66 Y B 0.0000
67 G B 0.0000
68 V B 0.0000
69 Q B 0.0000
70 C B 0.0000
71 F B 0.0000
72 S B 0.0000
73 R B -1.0212
74 Y B 0.0000
75 P B -1.7203
76 D B -2.8276
77 H B -2.3879
78 M B 0.0000
79 K B -2.5001
80 R B -2.7810
81 H B -1.7177
82 D B 0.0000
83 F B 0.0000
84 F B 0.0000
85 K B 0.0000
86 S B -0.9944
87 A B 0.0000
88 M B 0.0000
89 P B -1.1618
90 E B -1.5914
91 G B 0.0000
92 Y B 0.0000
93 V B -0.8105
94 Q B 0.0000
95 E B -2.9006
96 R B 0.0000
97 T B -0.5240
98 I B 0.0000
99 F B 0.4160
100 F B 0.0000
101 K B -1.8340
102 D B -2.8187
103 D B -2.5230
104 G B 0.0000
105 N B -0.5806
106 Y B 0.0000
107 K B -1.5933
108 T B 0.0000
109 R B -3.6142
110 A B 0.0000
111 E B -1.8332
112 V B 0.0000
113 K B -1.1250
114 F B -1.2666
115 E B -1.5686
116 G B -1.7020
117 D B -2.1377
118 T B -1.4337
119 L B 0.0000
120 V B 0.0000
121 N B 0.0000
122 R B -2.2261
123 I B 0.0000
124 E B -3.8713
125 L B 0.0000
126 K B -2.0369
127 G B 0.0000
128 I B -0.9579
129 D B -2.4277
130 F B 0.0000
131 K B -3.8668
132 E B -3.9232
133 D B -3.5584
134 G B 0.0000
135 N B -2.1077
136 I B 0.0000
137 L B -1.9814
138 G B -2.2796
139 H B -2.0780
140 K B -2.3043
141 L B 0.0000
142 E B -1.2245
143 Y B -0.2903
144 N B 0.0000
145 Y B 0.0000
146 N B 0.0000
147 S B 0.0000
148 H B 0.0000
149 N B -0.7065
150 V B 0.0000
151 Y B 0.1123
152 I B 0.0000
153 M B -0.7894
154 A B -1.6504
155 D B 0.0000
156 K B -3.1050
157 Q B -3.1423
158 K B -3.4342
159 N B -2.6660
160 G B 0.0000
161 I B 0.0000
162 K B -1.1978
163 V B 0.0000
164 N B -0.5912
165 F B 0.0000
166 K B -1.2912
167 I B 0.0000
168 R B -0.6129
169 H B 0.0000
170 N B -0.8106
171 I B 0.0000
172 E B -3.1315
173 D B -2.9555
174 G B -1.8234
175 S B -0.7917
176 V B 0.0871
177 Q B 0.0000
178 L B -0.4506
179 A B 0.0000
180 D B -0.5318
181 H B 0.0000
182 Y B -0.0622
183 Q B 0.0000
184 Q B -1.7769
185 N B 0.0000
186 T B -0.8505
187 P B -0.6336
188 I B -0.0037
189 G B -1.0686
190 D B -1.9679
191 G B -1.2447
192 P B -0.7173
193 V B -0.3833
194 L B -0.4045
195 L B -0.7767
196 P B 0.0000
197 D B -2.3336
198 N B -1.5670
199 H B 0.0000
200 Y B 0.0022
201 L B 0.0000
202 S B -0.2216
203 T B 0.0000
204 Q B 0.0000
205 S B 0.0000
206 A B 0.0000
207 L B 0.0000
208 S B 0.0000
209 K B -1.1390
210 D B -1.6802
211 P B -1.5058
212 N B -2.2889
213 E B -2.5510
214 K B -3.1433
215 R B -3.3897
216 D B -2.2834
217 H B 0.0000
218 M B 0.0000
219 V B 0.0000
220 L B 0.0000
221 L B -0.0442
222 E B 0.0000
223 F B 0.0000
224 V B 0.0000
225 T B -0.4358
226 A B 0.0000
227 A B -0.2147
228 G B -0.5231
229 I B -0.5519
230 T B -0.2004

 

Laboratory of Theory of Biopolymers 2015