Project name: 56e7ae78b848508

Status: done

submitted: 2017-11-14 10:16:21, status changed: 2017-11-14 11:42:59
Settings
Chain sequence(s) A: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCCIIWLAFVPIYFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
C: QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCCIIWLAFVPIYFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.8583
Maximal score value
2.7168
Average score
-0.6812
Total score value
-908.6656

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -0.3545
2 A A -0.2053
3 V A 0.0000
4 L A 1.1188
5 T A -0.0404
6 Q A -0.8518
7 P A -0.8040
8 P A -0.8017
9 S A -0.7544
10 V A -0.0137
11 S A 0.3047
12 G A 0.0000
13 A A -0.7837
14 P A -1.2281
15 G A -1.5852
16 Q A -2.0228
17 R A -2.3962
18 V A -1.0442
19 T A -0.6148
20 I A 0.0000
21 S A -0.3337
22 C A 0.0000
23 T A 0.0515
24 G A 0.0000
25 S A -0.4228
26 S A -0.2660
27 S A 0.1738
28 N A 0.0000
29 I A 1.6969
30 G A 0.3441
31 A A 0.9479
32 G A 0.0000
33 Y A 0.0000
34 G A 0.0000
35 V A 0.0000
36 H A 0.0000
37 W A 0.0000
38 Y A 0.0000
39 Q A 0.0000
40 Q A -0.4768
41 L A -0.4014
42 P A -0.5704
43 G A -0.7475
44 T A -0.7785
45 A A -1.1086
46 P A 0.0000
47 K A -1.0775
48 L A 0.0000
49 L A 0.0000
50 I A 0.0000
51 Y A -0.4230
52 G A -0.5813
53 D A -1.3321
54 S A -1.2799
55 N A -1.4098
56 R A -1.6507
57 P A 0.0000
58 S A -0.8921
59 G A -1.1109
60 V A -0.9146
61 P A -1.2275
62 D A -2.1309
63 R A -1.5169
64 F A 0.0000
65 S A -1.0378
66 G A -0.8133
67 S A -0.9579
68 K A -0.6540
69 S A -0.1574
70 G A 0.2116
71 T A -0.1382
72 S A -0.1347
73 A A 0.0000
74 S A -0.6096
75 L A 0.0000
76 A A -0.4964
77 I A 0.0000
78 T A -1.5670
79 G A -1.5018
80 L A 0.0000
81 Q A -1.5454
82 A A -1.5946
83 E A -2.1266
84 D A 0.0000
85 E A 0.0000
86 A A 0.0000
87 D A -0.8376
88 Y A 0.0000
89 Y A 0.0000
90 C A 0.0000
91 C A 0.0000
92 I A 0.0000
93 I A 1.2605
94 W A 2.2998
95 L A 2.5904
96 A A 1.7933
97 F A 2.5155
98 V A 2.1281
99 P A 1.0652
100 I A 0.0000
101 Y A 0.6923
102 F A 0.0000
103 G A 0.0000
104 G A -0.5722
105 G A -0.8497
106 T A 0.0000
107 Q A -1.0886
108 L A 0.0000
109 T A -0.1180
110 V A 0.0000
111 L A 0.2655
112 G A 0.0000
113 Q A -1.6693
114 P A -1.5399
115 K A -2.3878
116 A A -1.4828
117 A A -0.9874
118 P A 0.0000
119 S A -0.3073
120 V A -0.0813
121 T A 0.0862
122 L A 0.0000
123 F A 0.0000
124 P A -0.1910
125 P A 0.0000
126 S A -0.8082
127 S A -1.2764
128 E A -1.9775
129 E A 0.0000
130 L A -2.0495
131 Q A -2.3579
132 A A -1.7728
133 N A -2.7108
134 K A -2.5103
135 A A 0.0000
136 T A 0.0000
137 L A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 I A 0.0000
142 S A -0.2391
143 D A -0.7509
144 F A 0.0000
145 Y A -1.1615
146 P A -0.9605
147 G A -0.4570
148 A A -0.2785
149 V A -0.0957
150 T A -0.1968
151 V A 0.4747
152 A A 0.3308
153 W A 0.0000
154 K A -0.4620
155 A A 0.0000
156 D A -1.5112
157 S A -0.8798
158 S A -0.4998
159 P A -0.1167
160 V A 0.7071
161 K A -0.9029
162 A A -0.4746
163 G A -0.5327
164 V A 0.0681
165 E A -0.2273
166 T A -0.0845
167 T A -0.1432
168 T A -0.3037
169 P A -0.6924
170 S A -1.0642
171 K A -1.6313
172 Q A -2.1205
173 S A -1.2791
174 N A -1.4967
175 N A -1.4575
176 K A -1.5010
177 Y A -0.5336
178 A A 0.0000
179 A A -0.1527
180 S A 0.0000
181 S A 0.0000
182 Y A 0.0000
183 L A 0.0000
184 S A -0.5011
185 L A -0.9756
186 T A -1.5468
187 P A -2.3452
188 E A -2.8507
189 Q A -1.7631
190 W A -1.8855
191 K A -2.3396
192 S A -1.9440
193 H A -2.1685
194 R A -2.5718
195 S A -1.5081
196 Y A 0.0000
197 S A -0.3911
198 C A 0.0000
199 Q A -0.6423
200 V A 0.0000
201 T A -1.0262
202 H A 0.0000
203 E A -2.2791
204 G A -1.6926
205 S A -0.8558
206 T A -0.3601
207 V A 0.2811
208 E A -1.7835
209 K A -1.3337
210 T A -0.6648
211 V A 0.0276
212 A A -0.0501
213 P A 0.0000
214 T A -1.0885
215 E A -1.4740
216 C A -0.9332
217 S A -1.1557
218 Q B -1.3164
219 V B -1.1050
220 Q B -2.0934
221 L B 0.0000
222 V B -1.0988
223 Q B 0.0000
224 S B -0.9679
225 G B -0.8411
226 A B 0.0000
227 E B -1.3910
228 V B -1.0022
229 K B -1.7067
230 K B -2.3716
231 P B -2.4439
232 G B -2.3536
233 A B -1.6575
234 S B -1.5043
235 V B -1.3869
236 K B -1.6259
237 V B 0.0000
238 S B 0.0000
239 C B 0.0000
240 K B -1.5150
241 A B 0.0000
242 S B -0.7472
243 G B -0.6627
244 Y B -0.2172
245 T B -0.2379
246 F B 0.0000
247 T B -0.0789
248 N B -0.6926
249 Y B 0.2035
250 Y B 0.6534
251 M B 0.0000
252 H B 0.0000
253 W B 0.0000
254 V B 0.0000
255 R B 0.0000
256 Q B -0.5183
257 A B -0.8279
258 P B -0.9150
259 G B -1.2307
260 Q B -1.7349
261 G B -1.0867
262 L B 0.0000
263 E B -0.4677
264 W B 0.0000
265 V B 0.0000
266 G B 0.0000
267 W B 0.6269
268 I B 0.0000
269 N B 0.0000
270 P B 0.4402
271 Y B 0.9499
272 T B 0.3232
273 G B -0.0782
274 S B 0.2301
275 A B 0.4964
276 F B 1.1382
277 Y B -0.2053
278 A B -0.9494
279 Q B -2.5038
280 K B -2.8064
281 F B 0.0000
282 R B -2.7769
283 G B -2.0675
284 R B -2.4876
285 V B 0.0000
286 T B -0.9687
287 M B 0.0000
288 T B -0.2651
289 R B 0.0000
290 D B -0.0603
291 T B 0.2684
292 S B 0.5140
293 I B 1.4222
294 S B 0.2065
295 T B 0.0000
296 A B 0.0000
297 Y B -0.6767
298 M B 0.0000
299 E B -1.6717
300 L B 0.0000
301 S B -1.9459
302 R B -2.8322
303 L B 0.0000
304 R B -3.6005
305 S B -2.6478
306 D B -2.7145
307 D B 0.0000
308 T B -0.8879
309 A B 0.0000
310 V B 0.3562
311 Y B 0.0000
312 Y B 0.0000
313 C B 0.0000
314 A B 0.0000
315 R B 0.0000
316 E B -0.2120
317 P B -0.3031
318 E B -0.3647
319 K B 0.0000
320 F B 0.0000
321 D B 0.0000
322 S B -1.4893
323 D B -2.4325
324 D B -2.0099
325 S B 0.0000
326 D B -1.3538
327 V B 0.0000
328 W B 0.0000
329 G B 0.0000
330 R B -1.8693
331 G B -0.5889
332 T B -0.0697
333 L B 0.7776
334 V B 0.0000
335 T B -0.7032
336 V B 0.0000
337 S B -1.3743
338 S B -1.0607
339 A B -0.7746
340 S B -0.9305
341 T B -1.0450
342 K B -1.8233
343 G B -1.6330
344 P B -0.8297
345 S B -0.5965
346 V B 0.0000
347 F B -0.4162
348 P B -0.9070
349 L B 0.0000
350 A B -0.8570
351 P B -0.8377
352 S B -0.9505
353 S B -1.4901
354 K B -1.7997
355 S B -1.0920
356 T B -0.8830
357 S B -0.8448
358 G B -0.7540
359 G B -0.6815
360 T B -0.5027
361 A B 0.0000
362 A B -0.0414
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.4684
369 D B -0.8838
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -0.7736
374 P B -0.6635
375 V B -0.6044
376 T B -0.4763
377 V B -0.0664
378 S B -0.2957
379 W B 0.0000
380 N B -0.7256
381 S B -0.6275
382 G B -0.4303
383 A B -0.2247
384 L B -0.0530
385 T B -0.1509
386 S B -0.1453
387 G B -0.1192
388 V B 0.2626
389 H B 0.0000
390 T B 0.0481
391 F B 0.0000
392 P B 0.0432
393 A B 0.1958
394 V B 0.5941
395 L B 0.9891
396 Q B -0.4997
397 S B -0.4134
398 S B -0.4475
399 G B 0.0000
400 L B -0.1570
401 Y B 0.0602
402 S B 0.0000
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0869
409 V B 0.0000
410 P B -0.5457
411 S B -0.5647
412 S B -0.6436
413 S B -0.7331
414 L B -0.7881
415 G B -1.1206
416 T B -0.8833
417 Q B -1.3254
418 T B -1.1155
419 Y B -0.8680
420 I B -0.9919
421 C B 0.0000
422 N B -1.3757
423 V B 0.0000
424 N B -1.8496
425 H B 0.0000
426 K B -2.6901
427 P B -1.9153
428 S B -1.9425
429 N B -2.4881
430 T B -2.0971
431 K B -2.6071
432 V B -1.6816
433 D B -2.4109
434 K B -1.8254
435 K B -2.1214
436 V B -1.7440
437 E B -2.5916
438 P B -2.0388
439 K B -2.3388
440 S B -1.8056
441 C B -1.8102
442 D B -2.6183
443 K B -1.9991
444 T B -1.3712
445 H B -1.2056
446 T B -1.0345
447 C B 0.0000
448 P B -1.2420
449 P B -0.9060
450 C B -0.2648
451 P B -0.5474
452 A B -0.4022
453 P B -0.5699
454 E B -0.7550
455 L B 0.9125
456 L B 1.4417
457 G B 0.2247
458 G B -0.0754
459 P B 0.0000
460 S B -0.0013
461 V B 0.0000
462 F B 1.0516
463 L B 0.8634
464 F B 1.2443
465 P B -0.0826
466 P B 0.0000
467 K B -2.0941
468 P B -1.3264
469 K B -1.2699
470 D B -1.5087
471 T B 0.0000
472 L B 0.0000
473 M B 0.3930
474 I B 1.4799
475 S B -0.0911
476 R B -1.4436
477 T B -0.8355
478 P B 0.0000
479 E B -1.3768
480 V B 0.0000
481 T B 0.5203
482 C B 0.0000
483 V B 0.0000
484 V B 0.0000
485 V B -0.5347
486 D B -1.1923
487 V B 0.0000
488 S B -2.0351
489 H B -2.3257
490 E B -2.8630
491 D B -2.4890
492 P B -2.5093
493 E B -2.9177
494 V B 0.0000
495 K B -2.4944
496 F B 0.0000
497 N B -1.4522
498 W B 0.0000
499 Y B -0.7017
500 V B -0.4167
501 D B -1.4068
502 G B -0.3959
503 V B 1.2014
504 E B 0.1158
505 V B 0.5967
506 H B -1.0399
507 N B -1.0226
508 A B -1.0491
509 K B -1.9568
510 T B -1.2368
511 K B -1.9094
512 P B -1.7624
513 R B -3.0776
514 E B -3.8583
515 E B -3.3204
516 Q B -2.7270
517 Y B -1.6818
518 N B -1.5579
519 S B -1.3937
520 T B -1.7505
521 Y B -2.4858
522 R B -2.2610
523 V B 0.0000
524 V B -0.7641
525 S B 0.0000
526 V B -0.1184
527 L B 0.0000
528 T B -0.4937
529 V B 0.2523
530 L B 0.8358
531 H B -0.2355
532 Q B -1.3539
533 D B -1.2775
534 W B 0.0000
535 L B -1.1458
536 N B -2.0446
537 G B -1.9920
538 K B -2.0277
539 E B -2.1023
540 Y B 0.0000
541 K B -1.6849
542 C B 0.0000
543 K B -1.7999
544 V B 0.0000
545 S B -1.4526
546 N B -1.8180
547 K B -2.0692
548 A B -1.2324
549 L B -0.5528
550 P B -0.4138
551 A B -0.3386
552 P B -0.5071
553 I B -0.4479
554 E B -1.5856
555 K B -1.4690
556 T B -1.1908
557 I B -0.1884
558 S B -1.6157
559 K B -1.8409
560 A B -1.4780
561 K B -2.4280
562 G B -2.1980
563 Q B -2.2313
564 P B -2.3877
565 R B -3.1021
566 E B -2.9405
567 P B 0.0000
568 Q B -1.2254
569 V B 0.0000
570 Y B 0.0000
571 T B 0.0000
572 L B 0.0000
573 P B -0.3917
574 P B 0.0000
575 S B -1.3794
576 R B -2.5713
577 E B -2.7888
578 E B 0.0000
579 M B -1.3288
580 T B -1.6185
581 K B -2.8194
582 N B -2.9903
583 Q B -2.8628
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B -0.6614
592 G B -1.1904
593 F B 0.0000
594 Y B -1.4417
595 P B 0.0000
596 S B 0.0580
597 D B -0.8336
598 I B -0.5497
599 A B -0.4158
600 V B 0.0000
601 E B -0.7946
602 W B 0.0000
603 E B -1.7073
604 S B 0.0000
605 N B -2.0637
606 G B -1.8406
607 Q B -2.2099
608 P B -1.9194
609 E B -2.1397
610 N B -1.9944
611 N B -1.5842
612 Y B -0.8493
613 K B -0.4524
614 T B -0.2580
615 T B 0.0000
616 P B 0.0421
617 P B 0.2792
618 V B 0.7965
619 L B 1.0454
620 D B -0.3096
621 S B -1.2163
622 D B -1.9505
623 G B -0.8438
624 S B -0.8269
625 F B 0.0000
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -1.0040
633 V B 0.0000
634 D B -2.8838
635 K B -2.8371
636 S B -2.2775
637 R B -2.3946
638 W B -2.0315
639 Q B -2.5403
640 Q B -2.4406
641 G B -1.3689
642 N B -1.4004
643 V B -0.3328
644 F B 0.0000
645 S B -0.9500
646 C B 0.0000
647 S B 0.0000
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.2180
652 A B -2.0127
653 L B 0.0000
654 H B -1.8578
655 N B -1.7644
656 H B -1.2981
657 Y B -0.6429
658 T B -0.9401
659 Q B -0.9476
660 K B -1.0197
661 S B -0.2580
662 L B 0.0000
663 S B 0.2746
664 L B 1.3092
665 S B 0.3405
666 P B -0.1633
667 G B -0.7465
668 Q C -0.4638
669 A C -0.1486
670 V C 0.0000
671 L C 1.1244
672 T C -0.1069
673 Q C -1.0020
674 P C -0.8517
675 P C -0.8592
676 S C -0.8282
677 V C -0.1911
678 S C 0.0070
679 G C 0.0000
680 A C -0.7870
681 P C -1.1902
682 G C -1.6316
683 Q C -2.2704
684 R C -2.5331
685 V C 0.0000
686 T C -0.7497
687 I C 0.0000
688 S C -0.3494
689 C C 0.0000
690 T C 0.0438
691 G C 0.0000
692 S C -0.4636
693 S C -0.3576
694 S C 0.1408
695 N C 0.0000
696 I C 1.6944
697 G C 0.3347
698 A C 0.9455
699 G C 0.1571
700 Y C 0.7440
701 G C 0.0000
702 V C 0.0000
703 H C 0.0000
704 W C 0.0000
705 Y C 0.0000
706 Q C -0.5822
707 Q C -0.6582
708 L C -0.5715
709 P C -0.6031
710 G C -0.7237
711 T C -0.7641
712 A C -0.8561
713 P C 0.0000
714 K C -0.9748
715 L C 0.0000
716 L C 0.0000
717 I C 0.0000
718 Y C -0.9215
719 G C -0.8942
720 D C -1.6536
721 S C -1.9245
722 N C -2.4906
723 R C -2.9917
724 P C 0.0000
725 S C -1.5956
726 G C -1.1577
727 V C -1.2054
728 P C -1.5668
729 D C -2.2657
730 R C -1.3426
731 F C 0.0000
732 S C -1.3286
733 G C -1.1047
734 S C -0.9603
735 K C -0.5838
736 S C -0.1376
737 G C 0.2997
738 T C -0.1395
739 S C -0.1726
740 A C 0.0000
741 S C -0.5897
742 L C 0.0000
743 A C -0.5278
744 I C 0.0000
745 T C -1.5766
746 G C -1.5174
747 L C 0.0000
748 Q C -1.4536
749 A C -1.5397
750 E C -2.1046
751 D C 0.0000
752 E C -1.2422
753 A C 0.0000
754 D C -0.9655
755 Y C 0.0000
756 Y C 0.0000
757 C C 0.0000
758 C C 0.0000
759 I C 0.0000
760 I C 0.0000
761 W C 2.4726
762 L C 2.7168
763 A C 1.9106
764 F C 2.6380
765 V C 1.9415
766 P C 0.8984
767 I C 0.0000
768 Y C 0.8554
769 F C 0.0000
770 G C 0.0000
771 G C -0.5885
772 G C -0.8754
773 T C 0.0000
774 Q C -1.2695
775 L C 0.0000
776 T C 0.0000
777 V C 0.0000
778 L C 0.2124
779 G C -0.3727
780 Q C -0.9927
781 P C -1.1935
782 K C -2.2545
783 A C -1.4224
784 A C -0.9903
785 P C 0.0000
786 S C -0.2702
787 V C 0.0508
788 T C 0.1560
789 L C 0.0000
790 F C 0.0000
791 P C -0.2065
792 P C 0.0000
793 S C 0.0000
794 S C -1.2085
795 E C -2.0054
796 E C 0.0000
797 L C -2.2697
798 Q C -2.2631
799 A C -1.8041
800 N C -2.8425
801 K C -2.8135
802 A C 0.0000
803 T C 0.0000
804 L C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 I C 0.0000
809 S C 0.0000
810 D C -0.8033
811 F C 0.0000
812 Y C 0.0000
813 P C 0.0000
814 G C -0.3038
815 A C -0.2623
816 V C -0.1133
817 T C -0.1869
818 V C 0.4894
819 A C 0.3411
820 W C 0.0000
821 K C -0.3296
822 A C 0.0000
823 D C -1.0166
824 S C -0.6695
825 S C -0.3776
826 P C -0.0433
827 V C 0.7581
828 K C -0.8969
829 A C -0.4489
830 G C -0.3840
831 V C 0.0284
832 E C -0.1502
833 T C -0.1097
834 T C -0.1407
835 T C -0.2875
836 P C -0.6650
837 S C -0.9447
838 K C -1.6840
839 Q C -2.2528
840 S C -1.4046
841 N C -1.6868
842 N C -1.4430
843 K C -1.3935
844 Y C -0.5779
845 A C 0.0000
846 A C -0.1435
847 S C 0.0000
848 S C 0.0000
849 Y C 0.0000
850 L C 0.0000
851 S C -0.5609
852 L C -1.1617
853 T C -1.9463
854 P C 0.0000
855 E C -3.4297
856 Q C -2.7699
857 W C -2.5614
858 K C -3.2700
859 S C -2.3826
860 H C -2.4492
861 R C -2.6388
862 S C -1.3106
863 Y C 0.0000
864 S C -0.2525
865 C C 0.0000
866 Q C -0.4547
867 V C 0.0000
868 T C -0.9407
869 H C 0.0000
870 E C -2.2784
871 G C -1.7032
872 S C -0.8105
873 T C -0.3211
874 V C 0.3496
875 E C -1.6332
876 K C -1.0958
877 T C -0.4379
878 V C 0.2701
879 A C 0.0703
880 P C -0.6090
881 T C -0.8597
882 E C -1.1369
883 C C -0.5923
884 S C -0.6091
885 Q D -1.3096
886 V D -0.9245
887 Q D -1.2093
888 L D 0.0000
889 V D -0.2174
890 Q D 0.0000
891 S D -0.8201
892 G D -0.8674
893 A D 0.0000
894 E D -1.1825
895 V D -0.8649
896 K D -1.5588
897 K D -2.3300
898 P D -2.4562
899 G D -2.3065
900 A D -1.6415
901 S D -1.5355
902 V D -1.5266
903 K D -1.8578
904 V D 0.0000
905 S D -0.9711
906 C D 0.0000
907 K D -1.2319
908 A D 0.0000
909 S D -0.5771
910 G D -0.7224
911 Y D -0.2677
912 T D -0.3355
913 F D 0.0000
914 T D -0.2102
915 N D -0.9189
916 Y D -0.1787
917 Y D 0.1872
918 M D 0.0000
919 H D 0.0000
920 W D 0.0000
921 V D 0.0000
922 R D 0.0000
923 Q D -0.5696
924 A D -0.8648
925 P D -0.9294
926 G D -1.2413
927 Q D -1.7729
928 G D -1.0817
929 L D 0.0000
930 E D -0.6373
931 W D 0.0000
932 V D 0.0000
933 G D 0.0000
934 W D 0.0000
935 I D 0.0000
936 N D 0.1020
937 P D 0.1337
938 Y D 0.8029
939 T D 0.1600
940 G D -0.1417
941 S D 0.0041
942 A D 0.2004
943 F D 0.9117
944 Y D -0.2586
945 A D -1.2167
946 Q D -2.7269
947 K D -3.3209
948 F D 0.0000
949 R D -2.9022
950 G D -2.0697
951 R D -2.4502
952 V D 0.0000
953 T D -1.0156
954 M D 0.0000
955 T D -0.4135
956 R D -0.1337
957 D D -0.2350
958 T D 0.1509
959 S D 0.4866
960 I D 1.4253
961 S D 0.2008
962 T D 0.0000
963 A D 0.0000
964 Y D -0.8258
965 M D 0.0000
966 E D -1.7693
967 L D 0.0000
968 S D -1.9406
969 R D -2.7779
970 L D 0.0000
971 R D -3.6328
972 S D -2.6495
973 D D -2.7816
974 D D 0.0000
975 T D -0.8589
976 A D 0.0000
977 V D 0.4081
978 Y D 0.0000
979 Y D 0.0000
980 C D 0.0000
981 A D 0.0000
982 R D 0.0000
983 E D 0.0000
984 P D -0.3881
985 E D -0.1979
986 K D 0.0000
987 F D 0.0000
988 D D -1.4493
989 S D -1.6452
990 D D -2.8052
991 D D -2.6313
992 S D 0.0000
993 D D -1.1941
994 V D -0.5832
995 W D 0.0000
996 G D 0.0000
997 R D -1.4285
998 G D 0.0000
999 T D 0.0000
1000 L D 0.8370
1001 V D 0.0000
1002 T D -0.6350
1003 V D 0.0000
1004 S D -1.3569
1005 S D -1.0435
1006 A D -0.7092
1007 S D -0.8143
1008 T D -0.8037
1009 K D -1.3597
1010 G D -1.5408
1011 P D -0.7872
1012 S D -0.5551
1013 V D 0.0000
1014 F D -0.4170
1015 P D -1.0181
1016 L D 0.0000
1017 A D 0.0000
1018 P D -0.7482
1019 S D -0.7344
1020 S D -1.1073
1021 K D -1.9239
1022 S D -1.2306
1023 T D -0.9472
1024 S D -0.8762
1025 G D -0.7705
1026 G D -0.6975
1027 T D -0.5342
1028 A D -0.4161
1029 A D -0.0559
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.4808
1036 D D -0.8199
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.7653
1041 P D -0.7008
1042 V D -0.7137
1043 T D -0.5905
1044 V D -0.2933
1045 S D -0.3162
1046 W D 0.0000
1047 N D -0.6432
1048 S D -0.5916
1049 G D -0.3958
1050 A D -0.1636
1051 L D 0.0223
1052 T D -0.1061
1053 S D -0.1215
1054 G D -0.0595
1055 V D 0.2730
1056 H D 0.0000
1057 T D 0.0358
1058 F D 0.0000
1059 P D 0.0664
1060 A D 0.3014
1061 V D 0.8329
1062 L D 1.3556
1063 Q D 0.2521
1064 S D -0.0484
1065 S D -0.2634
1066 G D 0.0279
1067 L D 0.0841
1068 Y D 0.2992
1069 S D 0.0000
1070 L D 0.0000
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0759
1076 V D 0.0000
1077 P D -0.5957
1078 S D -0.6300
1079 S D -0.6894
1080 S D -0.8078
1081 L D 0.0000
1082 G D -1.2221
1083 T D -0.8968
1084 Q D -1.2886
1085 T D -1.2157
1086 Y D 0.0000
1087 I D -1.0838
1088 C D 0.0000
1089 N D -1.3838
1090 V D 0.0000
1091 N D -2.0252
1092 H D 0.0000
1093 K D -2.7303
1094 P D -1.8259
1095 S D -1.8596
1096 N D -2.5179
1097 T D -2.1515
1098 K D -2.5986
1099 V D -1.6676
1100 D D -2.4355
1101 K D -1.9202
1102 K D -2.3911
1103 V D 0.0000
1104 E D -2.5313
1105 P D -1.5183
1106 K D -1.0257
1107 S D -0.8040
1108 C D -0.3555
1109 D D -1.2214
1110 K D -1.1976
1111 T D -1.3648
1112 H D -1.3118
1113 T D -1.1190
1114 C D 0.0000
1115 P D -0.7535
1116 P D -0.6235
1117 C D -0.4670
1118 P D -0.7020
1119 A D 0.0000
1120 P D -0.9233
1121 E D -1.4343
1122 L D -0.0785
1123 L D 0.9259
1124 G D -0.1957
1125 G D -0.2072
1126 P D -0.2555
1127 S D -0.0202
1128 V D 0.0000
1129 F D 1.1324
1130 L D 0.0000
1131 F D 1.0660
1132 P D -0.0625
1133 P D 0.0000
1134 K D -2.1036
1135 P D -1.3593
1136 K D -0.9085
1137 D D -1.1950
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.7839
1141 I D 1.5246
1142 S D 0.0726
1143 R D -1.0891
1144 T D -0.6991
1145 P D 0.0000
1146 E D -1.3738
1147 V D 0.0000
1148 T D 0.5068
1149 C D 0.0000
1150 V D 0.0000
1151 V D 0.0000
1152 V D -0.0756
1153 D D -0.3469
1154 V D 0.0000
1155 S D -1.8623
1156 H D -2.2323
1157 E D -2.8291
1158 D D -2.2585
1159 P D -2.2588
1160 E D -2.4734
1161 V D 0.0000
1162 K D -2.4569
1163 F D -2.0299
1164 N D -1.9604
1165 W D 0.0000
1166 Y D -1.3507
1167 V D -0.8047
1168 D D -1.6360
1169 G D -0.6641
1170 V D 0.6439
1171 E D -1.0886
1172 V D -0.1910
1173 H D -1.3820
1174 N D -1.3340
1175 A D -1.1351
1176 K D -2.0866
1177 T D -1.4208
1178 K D -2.2749
1179 P D -2.0070
1180 R D -2.8086
1181 E D -3.0878
1182 E D -2.5031
1183 Q D -1.8482
1184 Y D -0.6086
1185 N D -0.8335
1186 S D -0.8456
1187 T D -1.1047
1188 Y D 0.0000
1189 R D -1.8506
1190 V D 0.0000
1191 V D -0.8123
1192 S D 0.0000
1193 V D -0.1807
1194 L D 0.0000
1195 T D -0.5716
1196 V D 0.0000
1197 L D 0.6866
1198 H D -0.2841
1199 Q D -1.1631
1200 D D -1.3278
1201 W D 0.0000
1202 L D -1.1124
1203 N D -2.0909
1204 G D -2.0798
1205 K D -2.0801
1206 E D -2.1286
1207 Y D 0.0000
1208 K D -1.9414
1209 C D 0.0000
1210 K D -1.9775
1211 V D 0.0000
1212 S D -1.4636
1213 N D -1.7981
1214 K D -2.1002
1215 A D -1.3002
1216 L D -0.6211
1217 P D -0.4983
1218 A D -0.3446
1219 P D -0.4896
1220 I D -0.5325
1221 E D -1.6275
1222 K D -1.6642
1223 T D -1.2092
1224 I D -0.0907
1225 S D -1.4441
1226 K D -1.4411
1227 A D -1.3561
1228 K D -2.3513
1229 G D -2.1163
1230 Q D -2.1916
1231 P D -2.3465
1232 R D -2.9206
1233 E D -2.7560
1234 P D 0.0000
1235 Q D -1.4798
1236 V D 0.0000
1237 Y D 0.0000
1238 T D -0.5637
1239 L D 0.0000
1240 P D -0.2195
1241 P D 0.0000
1242 S D -1.1131
1243 R D -2.1350
1244 E D -1.8391
1245 E D 0.0000
1246 M D -0.8721
1247 T D -1.1423
1248 K D -2.0459
1249 N D -2.5220
1250 Q D -2.3786
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D 0.0000
1259 G D -1.1026
1260 F D 0.0000
1261 Y D -1.4324
1262 P D -1.1836
1263 S D -0.3231
1264 D D -1.2737
1265 I D 0.0000
1266 A D 0.0000
1267 V D 0.0000
1268 E D -0.9997
1269 W D 0.0000
1270 E D -1.8631
1271 S D 0.0000
1272 N D -2.0877
1273 G D -1.8649
1274 Q D -2.2735
1275 P D -2.0881
1276 E D -2.4919
1277 N D -2.1233
1278 N D -1.5676
1279 Y D -0.8466
1280 K D -0.4049
1281 T D -0.2652
1282 T D 0.0000
1283 P D 0.0752
1284 P D 0.3360
1285 V D 1.0090
1286 L D 1.1687
1287 D D -0.2152
1288 S D -1.2007
1289 D D -1.9153
1290 G D -0.7452
1291 S D 0.0000
1292 F D 0.3203
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D -0.8493
1300 V D -1.1882
1301 D D -2.3991
1302 K D -2.4653
1303 S D -2.1171
1304 R D -2.2671
1305 W D -1.9399
1306 Q D -2.5109
1307 Q D -2.4301
1308 G D -1.5048
1309 N D -1.4087
1310 V D -0.4212
1311 F D 0.0000
1312 S D -1.0521
1313 C D 0.0000
1314 S D -0.4973
1315 V D 0.0000
1316 M D -0.3093
1317 H D 0.0000
1318 E D -1.3056
1319 A D -1.9171
1320 L D 0.0000
1321 H D -1.6118
1322 N D -1.5064
1323 H D -0.8327
1324 Y D 0.1229
1325 T D -0.6049
1326 Q D -0.9041
1327 K D -0.9946
1328 S D -0.2466
1329 L D 0.0000
1330 S D 0.2499
1331 L D 1.3323
1332 S D 0.2572
1333 P D -0.3153
1334 G D -0.8471

 

Laboratory of Theory of Biopolymers 2015