Project name: 5845f7632447144

Status: done

submitted: 2017-11-14 10:16:11, status changed: 2017-11-14 11:38:25
Settings
Chain sequence(s) A: QAVLTQPPSVSGAPGQRVTISCYLVLYLIIVVGMAYWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
C: QAVLTQPPSVSGAPGQRVTISCYLVLYLIIVVGMAYWYQQLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGYVFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGWINPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREPEKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.4134
Maximal score value
2.8013
Average score
-0.6539
Total score value
-872.3648

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A 0.2973
2 A A 1.1980
3 V A 0.0000
4 L A 1.7440
5 T A 0.3153
6 Q A -0.4314
7 P A -0.6475
8 P A -0.8177
9 S A -0.9155
10 V A -0.2751
11 S A -0.0884
12 G A 0.0000
13 A A -0.8611
14 P A -1.2134
15 G A -1.6538
16 Q A -2.3702
17 R A -2.6445
18 V A -1.1347
19 T A -0.6211
20 I A 0.0000
21 S A 0.0019
22 C A 0.0000
23 Y A 1.6655
24 L A 0.0000
25 V A 2.8013
26 L A 2.5784
27 Y A 2.6348
28 L A 0.0000
29 I A 2.4387
30 I A 1.4117
31 V A 0.6870
32 V A 0.0000
33 G A 0.0000
34 M A 0.0000
35 A A 0.0000
36 Y A 0.0000
37 W A 0.0000
38 Y A 0.0000
39 Q A 0.0000
40 Q A -0.4642
41 L A -0.1935
42 P A -0.6103
43 G A -0.6292
44 T A -0.6588
45 A A 0.0000
46 P A 0.0000
47 K A -0.9224
48 L A 0.0000
49 L A 0.0000
50 I A 0.0000
51 Y A 0.2134
52 G A 0.2560
53 D A -0.2692
54 S A -0.7295
55 N A -1.1421
56 R A -1.4710
57 P A -0.7250
58 S A -0.8891
59 G A -0.8213
60 V A -1.0419
61 P A -1.8153
62 D A -2.6289
63 R A -2.3950
64 F A 0.0000
65 S A -1.2027
66 G A 0.0000
67 S A -0.6174
68 K A -0.1045
69 S A 0.6016
70 G A 0.0000
71 T A 1.4878
72 S A 0.9577
73 A A 0.0000
74 S A -0.3409
75 L A 0.0000
76 A A -0.6413
77 I A 0.0000
78 T A -1.9186
79 G A 0.0000
80 L A 0.0000
81 Q A -1.3717
82 A A -1.4996
83 E A -2.0290
84 D A 0.0000
85 E A -1.2140
86 A A 0.0000
87 D A -1.0486
88 Y A 0.0000
89 Y A 0.0000
90 C A 0.0000
91 Q A 0.0000
92 S A 0.0000
93 Y A -0.5323
94 D A -1.2712
95 N A -1.6669
96 S A -0.0588
97 L A 0.7020
98 S A 0.1432
99 G A 0.0000
100 Y A 0.0000
101 V A 0.2893
102 F A 0.0000
103 G A 0.0000
104 G A -0.5624
105 G A -0.8520
106 T A 0.0000
107 Q A -1.4856
108 L A 0.0000
109 T A -0.3490
110 V A 0.0000
111 L A 0.0890
112 G A -0.4837
113 Q A -1.0793
114 P A -1.2549
115 K A -2.2713
116 A A -1.4494
117 A A -1.0132
118 P A 0.0000
119 S A -0.3252
120 V A -0.0225
121 T A 0.0989
122 L A 0.0000
123 F A 0.0000
124 P A -0.1442
125 P A 0.0000
126 S A -0.8321
127 S A -1.3197
128 E A -2.0799
129 E A 0.0000
130 L A -2.1600
131 Q A -2.5293
132 A A -1.8488
133 N A -2.8456
134 K A -2.7784
135 A A 0.0000
136 T A 0.0000
137 L A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 I A 0.0000
142 S A -0.3070
143 D A -0.9102
144 F A 0.0000
145 Y A 0.0000
146 P A 0.0000
147 G A -0.3255
148 A A -0.2606
149 V A -0.0874
150 T A -0.1179
151 V A 0.5477
152 A A 0.3685
153 W A 0.0000
154 K A -0.4968
155 A A 0.0000
156 D A -1.2111
157 S A -0.7581
158 S A -0.5202
159 P A -0.1492
160 V A 0.7107
161 K A -0.8910
162 A A -0.4798
163 G A -0.5180
164 V A 0.0663
165 E A -0.3570
166 T A -0.1332
167 T A -0.1536
168 T A -0.2989
169 P A -0.6886
170 S A -0.9740
171 K A -1.7920
172 Q A -2.2703
173 S A -1.3813
174 N A -1.6499
175 N A -1.5063
176 K A -1.4440
177 Y A -0.5264
178 A A 0.0000
179 A A -0.1714
180 S A 0.0000
181 S A 0.0000
182 Y A 0.0000
183 L A 0.0000
184 S A -0.5582
185 L A -1.0605
186 T A -1.7383
187 P A -2.5548
188 E A -3.0062
189 Q A -2.1639
190 W A -1.8110
191 K A -2.2051
192 S A -1.7743
193 H A -1.6181
194 R A -1.3855
195 S A -0.8860
196 Y A 0.0000
197 S A -0.2885
198 C A 0.0000
199 Q A -0.3678
200 V A 0.0000
201 T A -0.7247
202 H A 0.0000
203 E A -2.2127
204 G A -1.6344
205 S A -0.6769
206 T A -0.1715
207 V A 0.6232
208 E A -1.0818
209 K A -0.7820
210 T A -0.3407
211 V A 0.1267
212 A A 0.0007
213 P A -0.3884
214 T A -0.5001
215 E A -0.6259
216 C A 0.0843
217 S A -0.2805
218 Q B -1.6256
219 V B -1.2052
220 Q B -1.8659
221 L B 0.0000
222 V B -0.3239
223 Q B 0.0000
224 S B -0.7796
225 G B -0.7983
226 A B 0.0000
227 E B -1.2437
228 V B -0.8714
229 K B -1.5751
230 K B -2.2763
231 P B -2.2852
232 G B -2.0928
233 A B -1.5324
234 S B -1.5137
235 V B -1.4531
236 K B -1.7772
237 V B 0.0000
238 S B 0.0000
239 C B 0.0000
240 K B -0.9482
241 A B 0.0000
242 S B -0.6131
243 G B -0.8927
244 Y B -0.2808
245 T B -0.4009
246 F B 0.0000
247 T B -0.1431
248 N B -0.8255
249 Y B -0.0387
250 Y B 0.4263
251 M B 0.0000
252 H B 0.0000
253 W B 0.0000
254 V B 0.0000
255 R B 0.0000
256 Q B -0.6091
257 A B -0.9316
258 P B -0.8971
259 G B -1.1710
260 Q B -1.6715
261 G B -1.0487
262 L B -0.4602
263 E B -0.5531
264 W B 0.0000
265 V B 0.0000
266 G B 0.0000
267 W B 0.0000
268 I B 0.0000
269 N B 0.3166
270 P B 0.2600
271 Y B 0.9388
272 T B 0.2337
273 G B -0.0417
274 S B 0.2932
275 A B 0.6502
276 F B 1.2991
277 Y B -0.0761
278 A B -1.0938
279 Q B -2.7968
280 K B -3.3360
281 F B 0.0000
282 R B -2.9434
283 G B -2.2469
284 R B -2.8341
285 V B 0.0000
286 T B -1.1479
287 M B 0.0000
288 T B -0.3998
289 R B -0.0337
290 D B -0.1018
291 T B 0.2569
292 S B 0.5409
293 I B 1.5014
294 S B 0.3273
295 T B 0.0000
296 A B 0.0000
297 Y B -0.7520
298 M B 0.0000
299 E B -1.9494
300 L B 0.0000
301 S B -2.0654
302 R B -2.8033
303 L B 0.0000
304 R B -3.5808
305 S B -2.5861
306 D B -2.7624
307 D B 0.0000
308 T B -0.9653
309 A B 0.0000
310 V B 0.1189
311 Y B 0.0000
312 Y B 0.0000
313 C B 0.0000
314 A B 0.0000
315 R B 0.0000
316 E B -0.2321
317 P B -0.2810
318 E B -0.2453
319 K B 0.0000
320 F B 0.0000
321 D B 0.0000
322 S B -1.4880
323 D B -2.4637
324 D B -1.6348
325 S B 0.0000
326 D B -1.0998
327 V B 0.0000
328 W B 0.0000
329 G B 0.0000
330 R B -1.6040
331 G B 0.0000
332 T B 0.0000
333 L B 0.2856
334 V B 0.0000
335 T B 0.0000
336 V B 0.0000
337 S B -1.3204
338 S B -1.0141
339 A B -0.8088
340 S B -1.0016
341 T B -1.2088
342 K B -2.0692
343 G B -1.7347
344 P B -0.8467
345 S B -0.5858
346 V B 0.0000
347 F B -0.4531
348 P B -1.0338
349 L B 0.0000
350 A B 0.0000
351 P B -0.8742
352 S B -0.8552
353 S B -1.3262
354 K B -1.8063
355 S B -1.1424
356 T B -0.9583
357 S B -0.8875
358 G B -0.7760
359 G B -0.7088
360 T B -0.5226
361 A B 0.0000
362 A B -0.0534
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.3339
369 D B -0.8642
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -0.6293
374 P B -0.6075
375 V B -0.7428
376 T B -0.5038
377 V B -0.2463
378 S B -0.2910
379 W B 0.0000
380 N B -0.8667
381 S B -0.6378
382 G B -0.4022
383 A B -0.2055
384 L B -0.0086
385 T B -0.1281
386 S B -0.1625
387 G B -0.1711
388 V B 0.2310
389 H B 0.0000
390 T B 0.0236
391 F B 0.0000
392 P B 0.0485
393 A B 0.2689
394 V B 0.6870
395 L B 0.9400
396 Q B -0.3241
397 S B -0.2395
398 S B -0.4625
399 G B 0.0000
400 L B -0.0705
401 Y B 0.0948
402 S B 0.0272
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.0960
409 V B 0.0000
410 P B -0.5662
411 S B -0.5878
412 S B -0.6646
413 S B -0.7898
414 L B -0.9033
415 G B -1.1820
416 T B -0.9244
417 Q B -1.3931
418 T B -1.3910
419 Y B 0.0000
420 I B -1.3541
421 C B 0.0000
422 N B 0.0000
423 V B 0.0000
424 N B -1.8822
425 H B 0.0000
426 K B -2.6862
427 P B -1.8677
428 S B -2.0343
429 N B -2.5169
430 T B -2.0856
431 K B -2.5043
432 V B -1.5332
433 D B -2.2658
434 K B -1.9218
435 K B -2.6494
436 V B 0.0000
437 E B -2.8259
438 P B -2.0792
439 K B -1.9300
440 S B -1.1815
441 C B -0.4571
442 D B -0.6218
443 K B 0.0000
444 T B -1.2240
445 H B -1.5214
446 T B -1.0369
447 C B 0.0000
448 P B -0.7059
449 P B -0.4996
450 C B -0.7254
451 P B -0.8719
452 A B -0.8960
453 P B -0.8118
454 E B -1.1364
455 L B 0.5773
456 L B 1.3785
457 G B 0.1574
458 G B -0.1014
459 P B -0.2440
460 S B 0.0974
461 V B 0.0000
462 F B 0.9847
463 L B 0.6813
464 F B 0.8578
465 P B -0.2318
466 P B 0.0000
467 K B -2.1772
468 P B -1.4932
469 K B -1.2830
470 D B -1.4338
471 T B 0.0000
472 L B 0.0000
473 M B 0.5214
474 I B 1.5523
475 S B -0.0563
476 R B -1.3682
477 T B -0.7443
478 P B 0.0000
479 E B -1.1166
480 V B 0.0000
481 T B 0.5054
482 C B 0.0000
483 V B 0.0000
484 V B 0.0000
485 V B -0.0712
486 D B -0.7058
487 V B 0.0000
488 S B -1.8791
489 H B -2.3186
490 E B -2.9039
491 D B -2.5594
492 P B -2.7761
493 E B -3.3932
494 V B 0.0000
495 K B -2.6741
496 F B 0.0000
497 N B -1.5274
498 W B 0.0000
499 Y B -1.1389
500 V B -0.8846
501 D B -2.1297
502 G B -0.6799
503 V B 0.8757
504 E B -0.2955
505 V B 0.5685
506 H B -1.0343
507 N B -1.0582
508 A B -1.0686
509 K B -2.0704
510 T B 0.0000
511 K B -2.6178
512 P B -2.3750
513 R B -4.1115
514 E B -4.4134
515 E B -3.7057
516 Q B -2.5942
517 Y B -0.8619
518 N B -1.1725
519 S B -0.9108
520 T B -1.3813
521 Y B -2.4034
522 R B -2.2774
523 V B 0.0000
524 V B -1.1759
525 S B 0.0000
526 V B -0.0372
527 L B 0.0000
528 T B -0.3241
529 V B 0.4374
530 L B 1.0662
531 H B 0.0029
532 Q B -1.1058
533 D B -1.1680
534 W B 0.0000
535 L B -1.0262
536 N B -2.0584
537 G B -2.1417
538 K B -2.4652
539 E B -2.4961
540 Y B 0.0000
541 K B -1.9616
542 C B 0.0000
543 K B -1.8004
544 V B 0.0000
545 S B -1.5713
546 N B -1.9534
547 K B -2.1235
548 A B -1.2786
549 L B -0.6000
550 P B -0.4417
551 A B -0.3519
552 P B -0.5177
553 I B -0.4829
554 E B -1.4966
555 K B -1.6678
556 T B -1.4202
557 I B -0.3202
558 S B -1.7362
559 K B -1.6865
560 A B -1.3888
561 K B -2.3863
562 G B -2.1207
563 Q B -2.1444
564 P B -2.3275
565 R B -2.8302
566 E B -2.9156
567 P B 0.0000
568 Q B -1.5659
569 V B 0.0000
570 Y B 0.0000
571 T B 0.0000
572 L B -0.2598
573 P B -0.2785
574 P B -0.6488
575 S B -1.1330
576 R B -2.1499
577 E B -1.7387
578 E B 0.0000
579 M B -1.1395
580 T B -1.2559
581 K B -2.1686
582 N B -2.6700
583 Q B -2.6171
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B 0.0000
592 G B -1.1229
593 F B 0.0000
594 Y B -1.4059
595 P B 0.0000
596 S B -0.0808
597 D B -1.2248
598 I B 0.0000
599 A B -0.6431
600 V B 0.0000
601 E B -1.2025
602 W B 0.0000
603 E B -1.7039
604 S B 0.0000
605 N B -1.9804
606 G B -1.6929
607 Q B -2.0780
608 P B -1.8287
609 E B -1.9467
610 N B -1.9521
611 N B -1.5727
612 Y B -1.0653
613 K B -0.9560
614 T B -0.5300
615 T B 0.0000
616 P B 0.0132
617 P B 0.3086
618 V B 0.9153
619 L B 1.1239
620 D B -0.1998
621 S B -1.1633
622 D B -1.9157
623 G B -0.7989
624 S B -0.6594
625 F B 0.2622
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9838
633 V B 0.0000
634 D B -2.7267
635 K B -2.4477
636 S B -2.1178
637 R B -2.2806
638 W B -1.8542
639 Q B -2.2312
640 Q B -2.2269
641 G B -1.1248
642 N B -1.1824
643 V B -0.2493
644 F B 0.0000
645 S B -0.9886
646 C B 0.0000
647 S B -0.8044
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.7474
652 A B -2.1660
653 L B 0.0000
654 H B -1.9444
655 N B -1.8610
656 H B -1.4804
657 Y B -0.8909
658 T B -1.1440
659 Q B -1.2602
660 K B -1.0167
661 S B -0.3073
662 L B 0.3842
663 S B 0.4606
664 L B 1.1087
665 S B 0.0627
666 P B -0.2798
667 G B -0.1495
668 Q C -0.0662
669 A C 0.8734
670 V C 0.0000
671 L C 1.7152
672 T C 0.3350
673 Q C -0.2810
674 P C -0.5052
675 P C -0.7023
676 S C -0.7463
677 V C -0.1926
678 S C -0.1762
679 G C 0.0000
680 A C -0.9966
681 P C -1.3161
682 G C -1.6780
683 Q C -2.3749
684 R C -2.7608
685 V C 0.0000
686 T C -0.6522
687 I C 0.0000
688 S C 0.0000
689 C C 0.0000
690 Y C 1.3981
691 L C 0.0000
692 V C 2.3884
693 L C 2.1113
694 Y C 2.4743
695 L C 0.0000
696 I C 2.7163
697 I C 1.9139
698 V C 1.0446
699 V C 0.0000
700 G C 0.0000
701 M C 0.0000
702 A C 0.0000
703 Y C 0.0000
704 W C 0.0000
705 Y C 0.0000
706 Q C 0.0000
707 Q C -0.6675
708 L C -0.6299
709 P C -0.7436
710 G C -0.7834
711 T C -0.7834
712 A C 0.0000
713 P C 0.0000
714 K C -0.9281
715 L C 0.0000
716 L C 0.0000
717 I C 0.0000
718 Y C -0.1948
719 G C 0.0823
720 D C -0.2749
721 S C -0.9926
722 N C -1.7367
723 R C -2.0275
724 P C 0.0000
725 S C -1.7505
726 G C -1.4373
727 V C -1.3648
728 P C -1.7740
729 D C -2.9179
730 R C -2.9890
731 F C 0.0000
732 S C -1.4398
733 G C -0.7095
734 S C -0.6176
735 K C -0.0406
736 S C 0.6853
737 G C 1.7224
738 T C 1.3101
739 S C 0.8419
740 A C 0.0000
741 S C -0.3430
742 L C 0.0000
743 A C -0.7835
744 I C 0.0000
745 T C -2.1843
746 G C 0.0000
747 L C 0.0000
748 Q C -1.6664
749 A C -1.5877
750 E C -2.1469
751 D C 0.0000
752 E C 0.0000
753 A C 0.0000
754 D C -1.1428
755 Y C 0.0000
756 Y C 0.0000
757 C C 0.0000
758 Q C 0.0000
759 S C 0.0000
760 Y C -0.1122
761 D C -0.4768
762 N C -1.2358
763 S C 0.1388
764 L C 0.6564
765 S C -0.0048
766 G C 0.0000
767 Y C 0.0000
768 V C 0.1795
769 F C 0.0000
770 G C 0.0000
771 G C -0.5133
772 G C -0.8288
773 T C 0.0000
774 Q C -1.2869
775 L C 0.0000
776 T C -0.2906
777 V C 0.0000
778 L C -0.1681
779 G C -0.6907
780 Q C -1.3520
781 P C -1.4140
782 K C -2.3817
783 A C -1.5335
784 A C -1.0126
785 P C 0.0000
786 S C -0.2859
787 V C 0.0267
788 T C 0.1312
789 L C 0.0000
790 F C 0.0000
791 P C 0.0000
792 P C 0.0000
793 S C 0.0000
794 S C -1.2426
795 E C -2.0797
796 E C 0.0000
797 L C -2.0698
798 Q C -2.1671
799 A C -1.6671
800 N C -2.5587
801 K C -2.2369
802 A C 0.0000
803 T C 0.0000
804 L C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 I C 0.0000
809 S C -0.4041
810 D C -1.0438
811 F C 0.0000
812 Y C 0.0000
813 P C -1.0389
814 G C -0.3941
815 A C -0.2798
816 V C -0.1086
817 T C -0.1490
818 V C 0.5743
819 A C 0.3749
820 W C 0.0000
821 K C -0.2696
822 A C 0.0000
823 D C -1.0101
824 S C -0.6472
825 S C -0.3539
826 P C -0.0002
827 V C 0.8324
828 K C -0.7966
829 A C -0.2699
830 G C -0.1111
831 V C 0.5103
832 E C 0.1493
833 T C 0.0897
834 T C -0.0711
835 T C -0.3265
836 P C -0.7109
837 S C -0.9579
838 K C -1.7157
839 Q C -2.1737
840 S C -1.2195
841 N C -1.3353
842 N C 0.0000
843 K C -1.4826
844 Y C -0.5986
845 A C 0.0000
846 A C -0.1684
847 S C 0.0000
848 S C 0.0000
849 Y C 0.2038
850 L C 0.0000
851 S C -0.2499
852 L C -0.8823
853 T C -1.7633
854 P C 0.0000
855 E C -3.4195
856 Q C -2.6454
857 W C 0.0000
858 K C -3.3969
859 S C -2.4502
860 H C -2.5263
861 R C -2.5834
862 S C -1.3237
863 Y C 0.0000
864 S C -0.2684
865 C C 0.0000
866 Q C -0.3341
867 V C 0.0000
868 T C -0.7034
869 H C 0.0000
870 E C -2.2321
871 G C -1.6506
872 S C -0.6448
873 T C -0.1818
874 V C 0.6027
875 E C -1.1411
876 K C -0.5610
877 T C -0.2146
878 V C 0.2642
879 A C 0.0222
880 P C -0.6530
881 T C -0.8782
882 E C -1.2297
883 C C -0.2920
884 S C -0.5224
885 Q D -1.0832
886 V D -0.4812
887 Q D -1.3386
888 L D 0.0000
889 V D -0.3627
890 Q D 0.0000
891 S D -0.8764
892 G D -0.9759
893 A D 0.0000
894 E D -1.3924
895 V D -0.9356
896 K D -1.5669
897 K D -2.2950
898 P D -2.4307
899 G D -2.3432
900 A D -1.6207
901 S D -1.6665
902 V D -1.6886
903 K D -2.1170
904 V D 0.0000
905 S D -0.9910
906 C D 0.0000
907 K D -1.3261
908 A D -0.5913
909 S D -0.5564
910 G D -0.4922
911 Y D -0.1340
912 T D -0.2431
913 F D 0.0000
914 T D -0.1187
915 N D -0.7845
916 Y D 0.0728
917 Y D 0.5188
918 M D 0.0000
919 H D 0.0000
920 W D 0.0000
921 V D 0.0000
922 R D 0.0000
923 Q D -0.7147
924 A D -0.9802
925 P D -0.9323
926 G D -1.2407
927 Q D -1.8353
928 G D -1.2709
929 L D -0.7251
930 E D -0.8738
931 W D 0.0000
932 V D 0.0000
933 G D 0.0000
934 W D 0.8781
935 I D 0.0000
936 N D 0.0000
937 P D 0.0000
938 Y D 0.9925
939 T D 0.2855
940 G D 0.0546
941 S D 0.4506
942 A D 0.9491
943 F D 1.8214
944 Y D 0.1066
945 A D -0.9944
946 Q D -2.8041
947 K D -3.3756
948 F D 0.0000
949 R D -2.9113
950 G D -2.2926
951 R D -2.9558
952 V D 0.0000
953 T D -1.1725
954 M D 0.0000
955 T D -0.3364
956 R D -0.0153
957 D D -0.2709
958 T D 0.2043
959 S D 0.4915
960 I D 1.3893
961 S D 0.1816
962 T D 0.0000
963 A D 0.0000
964 Y D -0.7412
965 M D 0.0000
966 E D -2.1237
967 L D 0.0000
968 S D -2.1881
969 R D -2.9955
970 L D 0.0000
971 R D -3.7243
972 S D -2.6939
973 D D -2.8501
974 D D -2.2515
975 T D -1.0064
976 A D 0.0000
977 V D 0.3577
978 Y D 0.0000
979 Y D 0.0000
980 C D 0.0000
981 A D 0.0000
982 R D -0.0719
983 E D 0.0000
984 P D -0.3692
985 E D -0.4062
986 K D 0.0000
987 F D 0.0000
988 D D -1.5571
989 S D -1.9453
990 D D -2.7460
991 D D -2.8985
992 S D 0.0000
993 D D 0.0000
994 V D 0.0000
995 W D 0.0000
996 G D 0.0000
997 R D -1.5611
998 G D 0.0000
999 T D 0.0000
1000 L D 0.6893
1001 V D 0.0000
1002 T D -0.7150
1003 V D 0.0000
1004 S D -1.3679
1005 S D -1.0423
1006 A D -0.8261
1007 S D -1.0610
1008 T D -1.1920
1009 K D -2.1279
1010 G D -1.8244
1011 P D -0.8868
1012 S D -0.6554
1013 V D 0.0000
1014 F D 0.0000
1015 P D -1.1708
1016 L D 0.0000
1017 A D 0.0000
1018 P D -0.7838
1019 S D 0.0000
1020 S D -1.2303
1021 K D -1.9980
1022 S D -1.2609
1023 T D -0.9901
1024 S D -0.8911
1025 G D -0.7862
1026 G D -0.7296
1027 T D -0.5479
1028 A D -0.4179
1029 A D -0.0685
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.3379
1036 D D -0.8708
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.7969
1041 P D -0.6606
1042 V D -0.6117
1043 T D -0.4873
1044 V D 0.0661
1045 S D -0.3248
1046 W D 0.0000
1047 N D -0.7225
1048 S D -0.6638
1049 G D -0.5454
1050 A D -0.2171
1051 L D 0.0156
1052 T D -0.1263
1053 S D -0.1278
1054 G D -0.1148
1055 V D 0.2671
1056 H D 0.0000
1057 T D 0.0371
1058 F D 0.0000
1059 P D 0.0488
1060 A D 0.2815
1061 V D 0.7582
1062 L D 0.9305
1063 Q D -0.2813
1064 S D -0.3207
1065 S D -0.4625
1066 G D 0.0000
1067 L D -0.0680
1068 Y D 0.1408
1069 S D 0.0000
1070 L D 0.0000
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0901
1076 V D 0.0000
1077 P D -0.6035
1078 S D -0.6357
1079 S D -0.7165
1080 S D -0.8608
1081 L D 0.0000
1082 G D -1.2629
1083 T D -0.9665
1084 Q D -1.4269
1085 T D -1.3191
1086 Y D 0.0000
1087 I D -1.1499
1088 C D 0.0000
1089 N D -1.4598
1090 V D 0.0000
1091 N D -1.8346
1092 H D 0.0000
1093 K D -2.6780
1094 P D -1.9560
1095 S D -2.0272
1096 N D -2.4970
1097 T D -2.1055
1098 K D -2.6114
1099 V D -1.7216
1100 D D -2.5113
1101 K D -2.0285
1102 K D -2.6547
1103 V D 0.0000
1104 E D -2.6235
1105 P D -1.5878
1106 K D -1.0738
1107 S D -1.2094
1108 C D -0.8331
1109 D D -2.3218
1110 K D -2.4418
1111 T D -1.4156
1112 H D 0.0000
1113 T D -0.5894
1114 C D -0.6769
1115 P D -0.9069
1116 P D -0.7512
1117 C D -0.6274
1118 P D -0.7622
1119 A D 0.0000
1120 P D -0.9705
1121 E D -1.3489
1122 L D 0.0607
1123 L D 1.2813
1124 G D 0.0280
1125 G D -0.0526
1126 P D -0.0553
1127 S D 0.0071
1128 V D 0.0000
1129 F D 1.1388
1130 L D 0.0000
1131 F D 1.5202
1132 P D 0.0667
1133 P D 0.0000
1134 K D -1.8736
1135 P D -1.3010
1136 K D -0.8273
1137 D D 0.0000
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.8684
1141 I D 1.6940
1142 S D 0.3441
1143 R D -0.4529
1144 T D 0.0028
1145 P D 0.0000
1146 E D -0.5087
1147 V D 0.0000
1148 T D 0.8387
1149 C D 0.0000
1150 V D 0.6085
1151 V D 0.0000
1152 V D 0.1462
1153 D D -0.3638
1154 V D 0.0000
1155 S D -1.6697
1156 H D -2.1048
1157 E D -2.7643
1158 D D -2.0580
1159 P D -1.9434
1160 E D -1.8908
1161 V D 0.0000
1162 K D -2.0486
1163 F D 0.0000
1164 N D -1.4830
1165 W D 0.0000
1166 Y D -0.9314
1167 V D -0.7230
1168 D D -1.9250
1169 G D -0.6428
1170 V D 0.9389
1171 E D -0.1443
1172 V D 0.2687
1173 H D -1.2128
1174 N D -1.0777
1175 A D -1.0346
1176 K D -1.9976
1177 T D 0.0000
1178 K D -1.6700
1179 P D -1.7439
1180 R D -2.3551
1181 E D -2.7002
1182 E D -2.7648
1183 Q D -1.7472
1184 Y D -0.8058
1185 N D -0.9199
1186 S D -0.6977
1187 T D -1.0451
1188 Y D -1.5602
1189 R D -1.6268
1190 V D 0.0000
1191 V D -0.4863
1192 S D 0.0000
1193 V D 0.2552
1194 L D 0.0000
1195 T D -0.0623
1196 V D 0.5571
1197 L D 1.2239
1198 H D 0.2394
1199 Q D -0.8054
1200 D D -0.7831
1201 W D -0.7189
1202 L D -0.6257
1203 N D -1.6367
1204 G D -1.8830
1205 K D -1.9961
1206 E D -2.2422
1207 Y D 0.0000
1208 K D -1.7618
1209 C D 0.0000
1210 K D -1.7263
1211 V D 0.0000
1212 S D -1.3268
1213 N D -1.6692
1214 K D -2.0786
1215 A D -1.2723
1216 L D -0.6187
1217 P D -0.5003
1218 A D -0.3514
1219 P D -0.5361
1220 I D -0.4932
1221 E D -1.5736
1222 K D -1.3604
1223 T D -1.2460
1224 I D -0.2772
1225 S D -1.7554
1226 K D -2.1127
1227 A D -1.7156
1228 K D -2.5686
1229 G D -2.2276
1230 Q D -2.2267
1231 P D -2.4227
1232 R D -3.1263
1233 E D -2.9422
1234 P D 0.0000
1235 Q D -1.3874
1236 V D 0.0000
1237 Y D 0.0000
1238 T D 0.0000
1239 L D 0.0000
1240 P D -0.3694
1241 P D 0.0000
1242 S D -1.1726
1243 R D -2.2147
1244 E D -1.9077
1245 E D 0.0000
1246 M D -1.3017
1247 T D -1.3331
1248 K D -2.0934
1249 N D -2.4352
1250 Q D -2.2827
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D -0.7111
1259 G D -1.2264
1260 F D 0.0000
1261 Y D -1.4850
1262 P D 0.0000
1263 S D -0.0748
1264 D D -1.1280
1265 I D 0.0000
1266 A D -0.5506
1267 V D 0.0000
1268 E D -0.9717
1269 W D 0.0000
1270 E D -1.8914
1271 S D 0.0000
1272 N D -2.3415
1273 G D -1.9367
1274 Q D -2.2651
1275 P D -2.0803
1276 E D -2.4168
1277 N D -2.0491
1278 N D -1.4217
1279 Y D -0.7931
1280 K D -0.3667
1281 T D -0.2415
1282 T D 0.0000
1283 P D 0.0117
1284 P D 0.2299
1285 V D 0.6851
1286 L D 0.8599
1287 D D -0.4324
1288 S D -1.2999
1289 D D -1.9450
1290 G D -0.8386
1291 S D -0.8022
1292 F D 0.0847
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D -0.7677
1300 V D 0.0000
1301 D D -2.4694
1302 K D -2.6586
1303 S D -2.5050
1304 R D -3.1850
1305 W D -2.3687
1306 Q D -2.7706
1307 Q D -2.8301
1308 G D -1.9757
1309 N D -1.9420
1310 V D -1.1317
1311 F D 0.0000
1312 S D -1.0068
1313 C D 0.0000
1314 S D 0.0000
1315 V D 0.0000
1316 M D -0.6903
1317 H D 0.0000
1318 E D -1.5894
1319 A D -2.1205
1320 L D 0.0000
1321 H D -1.9021
1322 N D -1.8338
1323 H D -1.1836
1324 Y D -0.7857
1325 T D -1.0068
1326 Q D -1.0987
1327 K D -0.9474
1328 S D -0.5528
1329 L D -0.1941
1330 S D -0.7446
1331 L D 0.0000
1332 S D -1.0153
1333 P D -0.8363
1334 G D -1.2827

 

Laboratory of Theory of Biopolymers 2015