Project name: 58dfc414632ea2d

Status: done

submitted: 2018-03-09 12:46:27, status changed: 2018-03-09 13:36:10
Settings
Chain sequence(s) A: GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNVGVPTIQQLLEWSFINSNLKFAGAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMAGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0302
Maximal score value
2.2905
Average score
-0.7302
Total score value
-248.9862

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
583 G A -0.4231
584 L A -0.3353
585 E A -1.2160
586 I A 0.6490
587 M A 0.0000
588 I A -0.5046
589 G A -1.3910
590 K A -2.4350
591 K A -2.1682
592 K A -1.0279
593 G A 0.0000
594 I A 0.0000
595 Q A 0.0000
596 G A 0.0000
597 H A 0.2427
598 Y A 0.7203
599 N A -1.0301
600 S A 0.0000
601 C A 0.0000
602 Y A 0.0000
603 L A 0.0000
604 D A 0.0000
605 S A 0.0000
606 T A 0.0000
607 L A 0.0000
608 F A 0.0000
609 C A 0.0000
610 L A 0.0000
611 F A 0.0000
612 A A 0.0000
613 F A 0.0000
614 S A 0.0000
615 S A 0.2704
616 V A 0.1337
617 L A 0.0000
618 D A -0.0347
619 T A 0.2507
620 V A 0.0000
621 L A 0.0000
622 L A 0.8396
623 R A -0.5781
624 P A -1.3398
625 K A -3.2343
626 E A -4.0302
627 K A -3.6123
628 N A -3.3763
629 D A -2.9972
630 V A -2.1318
631 E A -2.0678
632 Y A -1.4330
633 Y A 0.0000
634 S A -1.9591
635 E A -2.4284
636 T A 0.0000
637 Q A 0.0000
638 E A -1.8274
639 L A 0.0000
640 L A 0.0000
641 R A -1.4072
642 T A -1.6515
643 E A -1.7093
644 I A 0.0000
645 V A 0.0000
646 N A -0.8587
647 P A 0.2253
648 L A 0.0000
649 R A 0.9137
650 I A 2.2905
651 Y A 2.0639
652 G A 0.0000
653 Y A 0.6063
654 V A 0.0000
655 C A 0.0889
656 A A 0.1407
657 T A -0.6569
658 K A -1.2999
659 I A 0.0000
660 M A -1.2236
661 K A -2.0842
662 L A 0.0000
663 R A -2.3003
664 K A -3.3284
665 I A 0.0000
666 L A 0.0000
667 E A -3.8816
668 K A -3.2550
669 V A -2.1678
670 E A -3.3806
679 E A -3.0542
680 K A -3.3906
681 D A -2.3441
682 P A 0.0000
683 E A -1.4520
684 E A -2.7826
685 F A 0.0000
686 L A 0.0000
687 N A -1.4983
688 I A 0.0000
689 L A 0.0000
690 F A 0.0000
691 H A -1.8945
692 H A -1.6507
693 I A 0.0000
694 L A 0.0000
695 R A -2.6040
696 V A 0.0000
697 E A -2.6533
698 P A -2.1146
699 L A -0.9483
700 L A 0.0000
701 K A -2.6242
702 I A 0.0000
703 R A -2.2463
704 S A -1.3393
705 A A -1.0508
706 G A -1.4272
707 Q A -2.3807
708 K A -2.7064
709 V A -2.1081
710 Q A -2.7703
711 D A -3.1102
712 C A -1.4722
713 Y A 0.0000
714 F A -0.0795
715 Y A 0.4326
716 Q A 0.3794
717 I A 0.0000
718 F A 1.4989
719 M A -0.3566
720 E A -2.4859
721 K A -2.9140
722 N A -2.0371
725 V A 0.6566
726 G A -0.5449
727 V A 0.0000
728 P A -0.5057
729 T A -0.1701
730 I A 0.0000
731 Q A -0.9679
732 Q A -0.7993
733 L A 0.0000
734 L A 0.0000
735 E A -0.8336
736 W A -0.4406
737 S A 0.0000
738 F A 0.0000
739 I A -0.7516
740 N A -1.3922
741 S A -0.8292
742 N A -1.1256
743 L A -0.9056
744 K A -0.9665
745 F A 0.0000
746 A A -1.3750
747 G A -0.9796
748 A A -0.8399
749 P A 0.0000
750 S A -0.1055
751 C A 0.0000
752 L A 0.0000
753 I A 0.0000
754 I A 0.0000
755 Q A 0.0000
756 M A 0.0000
757 P A 0.0000
758 R A 0.3259
759 F A 0.3993
760 G A -0.4508
761 K A -2.0186
762 D A -1.8187
763 F A 0.1323
764 K A -0.5988
765 L A 0.7266
766 F A 0.3603
767 K A -0.8182
768 K A -1.1479
769 I A 0.0000
770 F A 0.0555
771 P A 0.0000
772 S A 0.0000
773 L A -0.9079
774 E A -2.1063
775 L A 0.0000
776 N A -2.0970
777 I A 0.0000
778 T A -1.3532
779 D A -1.1973
780 L A 0.0000
781 L A 0.0000
782 E A -1.2195
783 D A -1.6636
784 T A -1.0465
785 P A -0.4422
786 R A 0.0000
787 Q A -0.6058
788 C A 0.0000
789 R A 0.3130
790 I A 1.7221
791 C A 1.3581
792 G A 0.4146
793 G A 0.3066
794 L A 0.7464
795 A A 0.0000
796 M A -0.1086
797 Y A -0.2856
798 E A -0.8573
799 C A 0.0000
800 R A -2.5961
801 E A -3.1952
802 C A 0.0000
803 Y A -1.9376
804 D A -2.8487
805 D A -2.1974
806 P A -1.8094
807 D A -2.1073
808 I A -0.9635
809 S A -0.7886
810 A A -1.4513
811 G A -1.6716
812 K A -1.8632
813 I A 0.0000
814 K A 0.0000
815 Q A 0.0000
816 F A 0.0000
817 C A -0.2213
818 K A -1.5926
819 T A -0.9115
820 C A 0.0000
821 N A 0.0000
822 T A -0.5429
823 Q A -0.9768
824 V A 0.0000
825 H A 0.0000
826 L A 0.8848
827 H A -0.3024
828 P A -0.5329
829 K A -1.5244
830 R A 0.0000
831 L A 0.3943
832 N A -1.4397
833 H A -2.0664
834 K A -2.4297
835 Y A -1.5757
836 N A -1.0545
837 P A -0.3962
838 V A 0.0000
839 S A -0.1176
840 L A 0.8545
857 Q A -1.7187
858 N A -1.9847
859 M A 0.0000
860 E A -1.3675
861 L A 0.0000
862 F A 0.0000
863 A A 0.0000
864 V A 0.0000
865 L A 0.0000
866 C A 0.0000
867 I A -0.5060
868 E A -0.9160
869 T A -0.7857
870 S A -0.6034
871 H A -0.5749
872 Y A -0.3433
873 V A 0.0000
874 A A 0.0000
875 F A 0.0000
876 V A 0.0000
877 K A -0.8258
878 Y A -0.1642
879 G A -1.3839
880 K A -2.8894
881 D A -3.4100
882 D A -3.3250
883 S A -2.4972
884 A A 0.0000
885 W A 0.0000
886 L A 0.0000
887 F A 0.0000
888 F A 0.0000
889 D A -0.4815
890 S A 0.0000
891 M A 0.4491
892 A A -0.3888
900 G A 0.4621
901 F A 1.7323
902 N A 0.6962
903 I A -0.1150
904 P A 0.0000
905 Q A -1.4083
906 V A 0.0000
907 T A -0.5403
908 P A -0.3061
909 C A 0.0000
910 P A -1.5279
911 E A -1.8656
912 V A 0.0000
913 G A 0.0000
914 E A -2.8005
915 Y A -1.7577
916 L A 0.0000
917 K A -2.3110
918 M A -1.5392
919 S A -1.3201
920 L A -1.4193
921 E A -2.4579
922 D A -2.2259
923 L A 0.0000
924 H A -2.0009
925 S A -1.3772
926 L A -1.1363
927 D A -1.6674
928 S A -2.0360
929 R A -3.0792
930 R A -2.9778
931 I A -1.9178
932 Q A -1.9254
933 G A -1.5864
934 C A -0.9324
935 A A 0.0000
936 R A -1.9845
937 R A -1.3277
938 L A 0.0000
939 L A 0.0000
940 C A -1.0771
941 D A -0.6452
942 A A 0.0000
943 Y A 0.0000
944 M A 0.0000
945 C A 0.0000
946 M A 0.0000
947 Y A 0.0000
948 Q A 0.0000
949 S A -0.4893
950 P A -0.9359
951 T A -0.1252
952 M A 0.1668
953 S A 0.1712
954 L A 0.8948
955 Y A 0.6102
956 K A -0.9102

 

Laboratory of Theory of Biopolymers 2015