Project name: 59215c6c3b5de41 [mutate: EA71L]

Status: done

submitted: 2017-11-14 12:05:49, status changed: 2017-11-14 12:11:56
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues EA71L
Energy difference between WT (input) and mutated protein (by FoldX) -0.400814 kcal/mol
Show buried residues

Minimal score value
-3.2198
Maximal score value
1.1439
Average score
-1.0483
Total score value
-103.7788

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.2683
2 D A -0.9629
3 V A 0.0000
4 L A -0.2744
5 L A 0.0000
6 G A 0.0000
7 A A -1.3436
8 D A -2.6885
9 D A -2.8698
10 G A -1.8110
11 S A -0.9389
12 L A -0.0976
13 A A 0.1419
14 F A 0.0000
15 V A 0.0226
16 P A -0.3851
17 S A -0.6943
18 E A -1.9182
19 F A -0.8216
20 S A -1.1194
21 I A 0.0000
22 S A -1.6774
23 P A -1.8529
24 G A -1.4367
25 E A -1.7307
26 K A -1.8081
27 I A 0.0000
28 V A -0.0680
29 F A 0.0000
30 K A -0.9964
31 N A 0.0000
32 N A -1.3638
33 A A -1.2163
34 G A -0.8381
35 F A -0.2510
36 P A -0.5504
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1230
43 E A -3.2186
44 D A -2.9228
45 S A -2.1398
46 I A -2.1045
47 P A -1.7535
48 S A -1.2726
49 G A -0.8343
50 V A -1.3179
51 D A -2.0569
52 A A -2.0737
53 S A -1.6384
54 K A -2.1056
55 I A 0.0000
56 S A -1.1244
57 M A -1.1253
58 S A -1.8623
59 E A -2.9589
60 E A -3.1081
61 D A -2.3430
62 L A -0.8149
63 L A 0.0000
64 N A -1.5801
65 A A -1.6393
66 K A -2.4660
67 G A -1.8965
68 E A -1.6904
69 T A -0.5268
70 F A 0.7662
71 L A 1.1439 mutated: EA71L
72 V A 0.0000
73 A A -1.0901
74 L A 0.0000
75 S A -1.8437
76 N A -2.6907
77 K A -3.2198
78 G A -2.3716
79 E A -2.5121
80 Y A 0.0000
81 S A -1.4848
82 F A 0.0000
83 Y A -0.3294
84 C A 0.0000
85 S A -1.1686
86 P A -0.8934
87 H A -0.5979
88 Q A -0.9723
89 G A -0.9386
90 A A -0.5229
91 G A -0.5169
92 M A 0.0000
93 V A 0.0831
94 G A 0.0000
95 K A -1.6714
96 V A 0.0000
97 T A -2.0483
98 V A 0.0000
99 N A -2.3830

 

Laboratory of Theory of Biopolymers 2015