Project name: 59215c6c3b5de41 [mutate: EA71L]

Status: done

submitted: 2017-11-14 12:05:49, status changed: 2017-11-14 12:11:56
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues EA71L
Energy difference between WT (input) and mutated protein (by FoldX) -0.400814 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.2198
Maximal score value
1.1439
Average score
-1.0483
Total score value
-103.7788

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.2683
2 D A -0.9629
3 V A 0.0000
4 L A -0.2744
5 L A 0.0000
6 G A 0.0000
7 A A -1.3436
8 D A -2.6885
9 D A -2.8698
10 G A -1.8110
11 S A -0.9389
12 L A -0.0976
13 A A 0.1419
14 F A 0.0000
15 V A 0.0226
16 P A -0.3851
17 S A -0.6943
18 E A -1.9182
19 F A -0.8216
20 S A -1.1194
21 I A 0.0000
22 S A -1.6774
23 P A -1.8529
24 G A -1.4367
25 E A -1.7307
26 K A -1.8081
27 I A 0.0000
28 V A -0.0680
29 F A 0.0000
30 K A -0.9964
31 N A 0.0000
32 N A -1.3638
33 A A -1.2163
34 G A -0.8381
35 F A -0.2510
36 P A -0.5504
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1230
43 E A -3.2186
44 D A -2.9228
45 S A -2.1398
46 I A -2.1045
47 P A -1.7535
48 S A -1.2726
49 G A -0.8343
50 V A -1.3179
51 D A -2.0569
52 A A -2.0737
53 S A -1.6384
54 K A -2.1056
55 I A 0.0000
56 S A -1.1244
57 M A -1.1253
58 S A -1.8623
59 E A -2.9589
60 E A -3.1081
61 D A -2.3430
62 L A -0.8149
63 L A 0.0000
64 N A -1.5801
65 A A -1.6393
66 K A -2.4660
67 G A -1.8965
68 E A -1.6904
69 T A -0.5268
70 F A 0.7662
71 L A 1.1439 mutated: EA71L
72 V A 0.0000
73 A A -1.0901
74 L A 0.0000
75 S A -1.8437
76 N A -2.6907
77 K A -3.2198
78 G A -2.3716
79 E A -2.5121
80 Y A 0.0000
81 S A -1.4848
82 F A 0.0000
83 Y A -0.3294
84 C A 0.0000
85 S A -1.1686
86 P A -0.8934
87 H A -0.5979
88 Q A -0.9723
89 G A -0.9386
90 A A -0.5229
91 G A -0.5169
92 M A 0.0000
93 V A 0.0831
94 G A 0.0000
95 K A -1.6714
96 V A 0.0000
97 T A -2.0483
98 V A 0.0000
99 N A -2.3830

 

Laboratory of Theory of Biopolymers 2015