Project name: igg4 Fc 2

Status: done

submitted: 2018-07-10 07:49:35, status changed: 2018-07-10 07:55:38
Settings
Chain sequence(s) A: LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTFPPSQEEMTKNQVSLRCLVKGFYPSDIAVEWESNGQPENNYKTTKPVLDSDGSFRLESRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.2643
Maximal score value
2.0533
Average score
-0.4021
Total score value
-84.4462

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
235 L A 1.4641
236 G A -0.2626
237 G A -0.4950
238 P A 0.0000
239 S A -0.0505
240 V A 0.0000
241 F A 1.0662
242 L A 0.0000
243 F A 1.1101
244 P A 0.0117
245 P A 0.0000
246 K A -1.7079
247 P A -0.4342
248 K A -0.5041
249 D A -0.2943
250 T A 0.0000
251 L A 0.3157
252 M A 0.8445
253 I A 2.0533
254 S A -0.1262
255 R A -1.5885
256 T A -0.3576
257 P A 0.0000
258 E A -0.8351
259 V A 0.0000
260 T A 0.0176
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.2329
265 D A -1.7554
266 V A 0.0000
267 S A -0.2913
268 Q A -1.5364
269 E A -2.0881
270 D A -0.6110
271 P A -0.4424
272 E A -1.7864
273 V A -0.3081
274 Q A -1.1121
275 F A -0.0135
276 N A -0.1532
277 W A 0.0000
278 Y A 0.0628
279 V A -0.0116
280 D A -1.5749
281 G A -0.4136
282 V A 1.3662
283 E A -1.3891
284 V A -0.0943
285 H A -1.1559
286 N A -1.4573
287 A A -0.5362
288 K A -1.7070
289 T A -0.6096
290 K A -1.3339
291 P A -0.7520
292 R A -1.8154
293 E A -2.2643
294 E A -2.1527
295 Q A -0.2407
296 F A 1.6621
297 N A -0.9628
298 S A -0.4401
299 T A -0.0185
300 Y A -0.2266
301 R A -0.7617
302 V A 0.0000
303 V A 0.2008
304 S A 0.0000
305 V A 0.2157
306 L A 0.0000
307 T A -0.1686
308 V A 0.0000
309 L A 1.1502
310 H A -0.1125
311 Q A -1.0123
312 D A -0.5427
313 W A 0.0000
314 L A 0.0512
315 N A -1.2335
316 G A -0.4129
317 K A -0.9521
318 E A -1.7458
319 Y A 0.0000
320 K A -0.5419
321 C A 0.0000
322 K A -0.6166
323 V A 0.0000
324 S A -0.1777
325 N A 0.0000
326 K A -1.7573
327 G A -0.5958
328 L A 0.0466
329 P A -0.2661
330 S A -0.2809
331 S A -0.0550
332 I A 0.2748
333 E A -1.6024
334 K A -1.1100
335 T A -0.2158
336 I A 0.3317
337 S A -0.2088
338 K A -0.1986
339 A A -0.3131
340 K A -1.7782
341 G A -0.9874
342 Q A -1.2972
343 P A -0.4300
344 R A -1.0452
345 E A -1.9512
346 P A 0.0000
347 Q A -0.9037
348 V A 0.8951
349 Y A 0.9918
350 T A 0.2218
351 F A 0.6723
352 P A -0.1248
353 P A -0.0927
354 S A -0.3701
355 Q A -1.5474
356 E A -2.1126
357 E A -0.7128
358 M A 0.1470
359 T A -0.3354
360 K A -1.9505
361 N A -1.7166
362 Q A -1.1408
363 V A 0.0000
364 S A -0.0305
365 L A 0.0000
366 R A -0.6314
367 C A 0.0000
368 L A 0.0886
369 V A 0.0000
370 K A -0.7904
371 G A -0.2569
372 F A 0.0000
373 Y A 0.1040
374 P A 0.0000
375 S A -0.2964
376 D A -1.2828
377 I A -0.0504
378 A A 0.0000
379 V A 0.0000
380 E A -0.5784
381 W A 0.0000
382 E A -1.0417
383 S A 0.0000
384 N A -1.3597
385 G A -0.9304
386 Q A -1.3328
387 P A -0.6530
388 E A -0.6185
389 N A -1.5462
390 N A -1.4396
391 Y A -0.1782
392 K A -1.6377
393 T A -0.3538
394 T A -0.3816
395 K A -1.7228
396 P A -0.2372
397 V A 1.0310
398 L A 1.6560
399 D A -0.0882
400 S A -0.5902
401 D A -1.8655
402 G A -0.5369
403 S A 0.0000
404 F A 0.3368
405 R A -0.7048
406 L A 0.0000
407 E A -1.7794
408 S A 0.0000
409 R A -1.8932
410 L A 0.0000
411 T A -0.0227
412 V A 0.0000
413 D A -1.4093
414 K A -0.7924
415 S A -0.5450
416 R A -0.6483
417 W A -0.0761
418 Q A -1.5091
419 E A -2.1248
420 G A -0.8776
421 N A -0.1845
422 V A 1.7345
423 F A 0.5129
424 S A -0.1094
425 C A 0.0481
426 S A -0.0330
427 V A 0.2223
428 M A 0.1634
429 H A 0.0000
430 E A -0.2153
431 A A -0.0950
432 L A 0.5128
433 H A -1.1065
434 N A -1.6509
435 H A -0.9905
436 Y A 1.1235
437 T A -0.0517
438 Q A -1.5236
439 K A -1.9605
440 S A -0.2511
441 L A 1.4696
442 S A 0.3489
443 L A 1.4713
444 S A 0.0647

 

Laboratory of Theory of Biopolymers 2015