Project name: 5c97c99e750793b

Status: done

submitted: 2017-09-14 12:41:40, status changed: 2017-09-14 12:47:29
Settings
Chain sequence(s) A: RPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVELLKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.1746
Maximal score value
2.0329
Average score
-0.7714
Total score value
-110.3139

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
10 R A -2.4185
11 P A -1.5418
12 R A -1.6175
13 M A 0.4029
14 V A 0.8079
15 D A -1.5198
16 V A -1.5464
17 T A -1.9116
18 E A -3.0579
19 K A -3.0551
20 P A -2.3234
21 E A -2.7126
22 T A -0.9715
23 F A 0.6093
24 R A 0.0000
25 T A -0.5863
26 A A 0.0000
27 T A -0.7957
28 A A 0.0000
29 E A 0.0000
30 A A 0.0000
31 F A -0.6393
32 V A 0.0000
33 E A -0.7568
34 L A 0.0000
35 T A -1.7924
36 E A -2.8963
37 E A -2.6834
38 A A 0.0000
39 L A -2.4573
40 S A -2.3698
41 A A -2.1055
42 L A 0.0000
43 E A -3.0345
44 K A -2.9343
45 G A -2.2613
49 K A -2.0799
50 G A -1.1647
51 D A -1.1026
52 P A 0.0000
53 L A 0.3898
54 V A 1.7978
55 V A 1.9552
56 A A 0.0000
57 Q A 0.6709
58 L A 2.0329
59 A A 1.8096
60 G A 0.0000
61 I A 0.2448
62 L A 0.5115
63 A A 0.0000
64 A A 0.0000
65 K A -2.2273
66 K A -2.1872
67 T A 0.0000
68 A A -0.7986
69 D A -1.5594
70 L A 0.7122
71 I A 0.7995
72 P A 0.3148
73 L A 0.9188
74 C A 0.6970
75 H A 0.0696
76 P A -0.6441
77 L A -0.4636
78 P A -0.6532
79 L A -0.5907
80 T A -0.2367
81 G A -0.5296
82 V A -0.7079
83 E A -1.9429
84 V A 0.0000
85 R A -2.6725
86 V A -1.4824
87 E A -2.5766
88 L A 0.0000
89 L A -1.9537
90 K A -2.4655
91 A A -1.7321
92 E A -2.9711
93 K A -3.1746
94 R A -2.3349
95 V A 0.0000
96 R A -2.6640
97 I A 0.0000
98 E A -2.1822
99 A A 0.0000
100 T A -1.1310
101 V A 0.0000
102 K A -0.9400
103 T A 0.0000
104 K A -1.4836
105 A A 0.0000
106 E A -2.2323
107 T A -1.1264
108 G A -0.5289
109 V A 0.0000
110 E A -0.6279
111 M A 0.3296
112 E A 0.0000
113 A A 0.0000
114 M A 0.1740
115 T A 0.0000
116 A A 0.0000
117 C A 0.0000
118 A A 0.6258
119 V A 1.3208
120 A A 0.0000
121 A A 0.0000
122 L A 1.7142
123 T A 0.8580
124 V A 0.0000
125 Y A 0.0053
126 D A -1.3387
127 M A 0.0000
128 L A 0.0000
129 K A -1.8243
130 A A -0.9402
131 A A -0.9900
132 S A 0.0000
133 K A -2.0986
134 G A -0.9256
135 L A 0.0000
136 V A 1.5285
137 I A 1.3777
138 S A 0.2129
139 Q A -0.7667
140 V A -0.0997
141 R A -0.7873
142 L A -0.6837
143 L A -1.1520
144 H A -1.6703
145 K A -1.5238
146 A A -1.2660
147 G A -0.8665
148 G A -1.7690
149 K A -2.2242
150 S A -1.5441
151 G A -1.7058
152 E A -2.4643
153 W A -1.8269
154 R A -2.9216
155 R A -2.6588

 

Laboratory of Theory of Biopolymers 2015