Project name: 5fa459770ad1f2d

Status: done

submitted: 2017-12-06 11:47:32, status changed: 2017-12-06 13:07:52
Settings
Chain sequence(s) A: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCILVSGGIGWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: QSVLTQPPSVSGAPGQRVTISCSGSRSNIGSNTVKWYQQLPGTAPKLLIYYNDQRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRYTHPALLFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
B: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCILVSGGIGWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: QSVLTQPPSVSGAPGQRVTISCSGSRSNIGSNTVKWYQQLPGTAPKLLIYYNDQRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRYTHPALLFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1756
Maximal score value
1.5087
Average score
-0.804
Total score value
-1064.4641

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.1111
2 V A -0.2745
3 Q A -0.5610
4 L A 0.0000
5 V A 1.1332
6 E A 0.0000
7 S A -0.3314
8 G A -0.5583
9 G A -0.1614
10 G A 0.2615
11 V A 0.9703
12 V A 0.0000
13 Q A -2.0705
14 P A -2.5796
15 G A -2.4972
16 R A -2.9195
17 S A -2.6168
18 L A -1.4221
19 R A -2.0050
20 L A 0.0000
21 S A -0.2232
22 C A 0.0000
23 A A -0.0379
24 A A 0.0000
25 S A -0.5447
26 G A -0.8724
27 F A -0.1193
28 T A 0.0372
29 F A 0.0000
30 S A -1.3641
31 S A -0.2635
32 Y A 0.4660
33 G A -0.7678
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.8097
39 Q A -1.1746
40 A A 0.0000
41 P A -1.3612
42 G A -1.5542
43 K A -2.4326
44 G A -1.6681
45 L A 0.0000
46 E A -1.3173
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 F A 0.0000
51 I A 0.0000
52 R A -2.8385
53 Y A 0.0000
54 D A -2.9971
55 G A -2.5242
56 S A -2.5697
57 N A -2.3874
58 K A -1.1626
59 Y A -0.4089
60 Y A -0.8298
61 A A 0.0000
62 D A -2.6678
63 S A -2.0004
64 V A 0.0000
65 K A -2.8700
66 G A -2.6008
67 R A -3.1197
68 F A -1.8881
69 T A -1.1991
70 I A 0.0000
71 S A -0.8246
72 R A -1.7927
73 D A -1.9965
74 N A -2.6450
75 S A -1.9169
76 K A -2.5147
77 N A -1.8660
78 T A -0.9853
79 L A 0.0000
80 Y A -0.4325
81 L A 0.0000
82 Q A -1.4870
83 M A 0.0000
84 N A -2.9260
85 S A -2.4029
86 L A 0.0000
87 R A -3.3917
88 A A -2.1862
89 E A -2.5960
90 D A -2.0085
91 T A -0.8494
92 A A 0.0000
93 V A 0.0912
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 I A 0.6647
98 L A 0.4475
99 V A 0.0000
100 S A 0.0000
101 G A 0.0000
102 G A 0.0000
103 I A 1.4768
104 G A 0.6809
105 W A 0.0000
106 G A 0.0000
107 Q A -0.8624
108 G A 0.0000
109 T A 0.0000
110 M A 0.5080
111 V A 0.0000
112 T A -0.1592
113 V A 0.0000
114 S A -1.2014
115 S A -0.8090
116 A A -0.6114
117 S A -0.5369
118 T A -0.8580
119 K A -1.4213
120 G A -1.3874
121 P A -0.6803
122 S A -0.1138
123 V A 0.0000
124 F A -0.2688
125 P A -0.9321
126 L A 0.0000
127 A A 0.0000
128 P A 0.0000
129 S A -1.3633
130 S A -1.3311
131 K A -2.0240
132 S A -1.3696
133 T A -1.0975
134 S A -0.9080
135 G A -0.8625
136 G A -0.9120
137 T A -0.7831
138 A A -0.5821
139 A A 0.0000
140 L A 0.0000
141 G A 0.0000
142 C A 0.0000
143 L A 0.0000
144 V A 0.0000
145 K A 0.0000
146 D A -0.2826
147 Y A 0.0000
148 F A 0.0000
149 P A -0.8730
150 E A -1.5088
151 P A -1.2595
152 V A -0.9230
153 T A -0.6889
154 V A -0.2508
155 S A -0.5100
156 W A 0.0000
157 N A -0.8544
158 S A -0.7538
159 G A -0.6096
160 A A -0.2840
161 L A -0.0929
162 T A -0.2327
163 S A -0.2308
164 G A -0.2819
165 V A 0.0854
166 H A 0.0000
167 T A 0.0155
168 F A 0.0000
169 P A -0.2242
170 A A -0.0729
171 V A 0.4410
172 L A 0.8521
173 Q A 0.1728
174 S A -0.1665
175 S A -0.2416
176 G A -0.0436
177 L A -0.0674
178 Y A 0.2518
179 S A 0.0000
180 L A 0.0000
181 S A 0.0000
182 S A 0.0000
183 V A 0.0000
184 V A 0.0000
185 T A -0.1786
186 V A 0.0000
187 P A -0.4926
188 S A -0.6278
189 S A -0.5187
190 S A -0.6336
191 L A -0.7937
192 G A -1.0164
193 T A -0.8195
194 Q A -1.4200
195 T A -1.2588
196 Y A 0.0000
197 I A -1.5682
198 C A 0.0000
199 N A -1.6579
200 V A 0.0000
201 N A -1.9586
202 H A 0.0000
203 K A -2.8924
204 P A -1.8719
205 S A -2.0322
206 N A -2.6155
207 T A -2.1006
208 K A -2.6408
209 V A -1.5922
210 D A -2.5624
211 K A -2.0488
212 K A -2.5652
213 V A 0.0000
214 E A -2.9600
215 P A -2.0142
216 K A -2.4930
217 S A -1.8881
218 C A -1.0505
219 D A -2.3930
220 K A -3.0404
221 T A -2.3565
222 H A -2.2603
223 T A 0.0000
224 C A -0.4955
225 P A -0.5335
226 P A -0.1232
227 C A 0.4018
228 P A -0.3277
229 A A -1.0259
230 P A -1.2107
231 E A -1.4059
232 L A 1.0815
233 L A 1.2352
234 G A 0.3679
235 G A -0.2080
236 P A 0.0000
237 S A -0.0979
238 V A 0.0000
239 F A 1.0227
240 L A 0.8092
241 F A 1.0427
242 P A -0.1780
243 P A 0.0000
244 K A -2.2522
245 P A -1.3481
246 K A -1.3170
247 D A 0.0000
248 T A 0.0000
249 L A 0.0000
250 M A 0.2302
251 I A 1.2498
252 S A -0.1701
253 R A -1.7008
254 T A -0.8736
255 P A 0.0000
256 E A -1.1399
257 V A 0.0000
258 T A 0.4454
259 C A 0.0000
260 V A 0.0000
261 V A 0.0000
262 V A -0.9293
263 D A -1.5289
264 V A 0.0000
265 S A -2.0381
266 H A -2.5597
267 E A -2.9408
268 D A 0.0000
269 P A -2.5082
270 E A -2.8975
271 V A -1.8529
272 K A -2.1693
273 F A -1.2604
274 N A -1.1169
275 W A 0.0000
276 Y A -0.5998
277 V A -0.6365
278 D A -1.7386
279 G A -0.5044
280 V A 0.9946
281 E A -0.3418
282 V A -0.2797
283 H A -1.7659
284 N A -2.0727
285 A A -1.6147
286 K A -2.4189
287 T A -2.0319
288 K A -2.5412
289 P A -2.3997
290 R A -3.7594
291 E A -4.1756
292 E A -3.6328
293 Q A -2.2058
294 Y A -0.0340
295 N A -1.2940
296 S A -1.3801
297 T A -2.0339
298 Y A 0.0000
299 R A -3.2087
300 V A 0.0000
301 V A 0.0000
302 S A 0.0000
303 V A -0.7482
304 L A 0.0000
305 T A -0.6365
306 V A 0.0000
307 L A 0.1027
308 H A -0.5747
309 Q A -1.5631
310 D A -1.6939
311 W A 0.0000
312 L A -1.1407
313 N A -2.1850
314 G A -2.1075
315 K A -2.2509
316 E A -2.4842
317 Y A 0.0000
318 K A -1.6189
319 C A 0.0000
320 K A -1.6849
321 V A 0.0000
322 S A -1.4420
323 N A 0.0000
324 K A -2.3141
325 A A -1.4427
326 L A 0.0000
327 P A -0.3546
328 A A -0.4556
329 P A -0.8182
330 I A -0.7683
331 E A -2.1536
332 K A -1.3571
333 T A -1.1239
334 I A -0.3423
335 S A -1.2137
336 K A -1.2610
337 A A -0.9610
338 K A -2.2013
339 G A -1.8349
340 Q A -2.0689
341 P A -2.2712
342 R A -2.8624
343 E A -2.8948
344 P A 0.0000
345 Q A -1.1822
346 V A 0.0000
347 Y A 0.0000
348 T A 0.0000
349 L A 0.0000
350 P A -0.4117
351 P A 0.0000
352 S A -1.4871
353 R A -2.6726
354 E A -2.8707
355 E A 0.0000
356 M A -1.9274
357 T A -1.7830
358 K A -2.4921
359 N A -2.6769
360 Q A -2.3979
361 V A 0.0000
362 S A 0.0000
363 L A 0.0000
364 T A 0.0000
365 C A 0.0000
366 L A 0.0000
367 V A 0.0000
368 K A -0.5349
369 G A -1.2299
370 F A 0.0000
371 Y A -1.2356
372 P A 0.0000
373 S A -0.1555
374 D A -0.7526
375 I A -0.4514
376 A A 0.0000
377 V A -0.3722
378 E A -1.1293
379 W A 0.0000
380 E A -1.6531
381 S A 0.0000
382 N A -1.8607
383 G A -1.8718
384 Q A -2.3107
385 P A -1.9626
386 E A -1.8210
387 N A -2.0532
388 N A -1.4665
389 Y A -1.0048
390 K A -1.1359
391 T A -0.4645
392 T A 0.0000
393 P A -0.1560
394 P A 0.1505
395 V A 0.4353
396 L A 0.5755
397 D A -0.6081
398 S A -1.1713
399 D A -1.9141
400 G A -1.0345
401 S A 0.0000
402 F A 0.0361
403 F A 0.0000
404 L A 0.0000
405 Y A 0.0000
406 S A 0.0000
407 K A 0.0000
408 L A 0.0000
409 T A -0.9211
410 V A 0.0000
411 D A -2.5895
412 K A -2.8618
413 S A -2.3165
414 R A -2.0435
415 W A 0.0000
416 Q A -2.5562
417 Q A -2.4722
418 G A -1.5946
419 N A -0.9035
420 V A 0.5920
421 F A 0.0000
422 S A -0.6740
423 C A 0.0000
424 S A 0.0000
425 V A 0.0000
426 M A 0.0000
427 H A 0.0000
428 E A -1.1608
429 A A -1.8589
430 L A 0.0000
431 H A -1.9280
432 N A -1.8165
433 H A -1.3705
434 Y A -0.5980
435 T A -0.8157
436 Q A -1.2013
437 K A -0.9357
438 S A -0.3327
439 L A 0.0000
440 S A -0.0386
441 L A -0.6091
442 S A -0.7425
443 P A -0.9893
444 G A -1.6814
445 K A -2.5248
446 Q B -1.1412
447 V B -0.2490
448 Q B -0.8866
449 L B 0.0000
450 V B 0.3303
451 E B -0.3817
452 S B -0.7775
453 G B -0.7485
454 G B -0.3839
455 G B 0.2102
456 V B 1.3140
457 V B -0.0319
458 Q B -1.0934
459 P B -1.7389
460 G B -2.1382
461 R B -2.5459
462 S B -2.0017
463 L B -1.2502
464 R B -1.9800
465 L B 0.0000
466 S B -0.4458
467 C B 0.0000
468 A B -0.4570
469 A B 0.0000
470 S B -0.4993
471 G B -0.6718
472 F B -0.1373
473 T B -0.1369
474 F B 0.0000
475 S B -1.4392
476 S B -0.5766
477 Y B -0.3244
478 G B 0.0000
479 M B 0.0000
480 H B 0.0000
481 W B 0.0000
482 V B 0.0000
483 R B -0.5467
484 Q B -0.8630
485 A B -1.2232
486 P B -1.1629
487 G B -1.3066
488 K B -1.8702
489 G B -1.0903
490 L B -0.6053
491 E B -0.7906
492 W B 0.0000
493 V B 0.0000
494 A B 0.0000
495 F B -0.2776
496 I B 0.0000
497 R B -2.4375
498 Y B -2.3558
499 D B -2.6988
500 G B -2.2691
501 S B -2.2675
502 N B -2.2656
503 K B -1.3836
504 Y B -0.8873
505 Y B -0.9667
506 A B -1.5166
507 D B -2.5771
508 S B -1.7802
509 V B 0.0000
510 K B -2.6265
511 G B -1.9347
512 R B -1.5756
513 F B 0.0000
514 T B -0.9486
515 I B 0.0000
516 S B -0.9133
517 R B -1.9117
518 D B -2.3617
519 N B -2.9154
520 S B -2.0510
521 K B -2.6136
522 N B -2.2061
523 T B 0.0000
524 L B 0.0000
525 Y B -0.5379
526 L B 0.0000
527 Q B -1.2533
528 M B 0.0000
529 N B -2.1062
530 S B -1.8819
531 L B 0.0000
532 R B -2.5517
533 A B -1.5448
534 E B -2.2280
535 D B 0.0000
536 T B -0.4764
537 A B 0.0000
538 V B 0.0055
539 Y B 0.0000
540 Y B 0.0000
541 C B 0.0000
542 I B 0.0000
543 L B 0.0000
544 V B 0.0000
545 S B -0.2181
546 G B -0.2170
547 G B 0.1879
548 I B 1.5087
549 G B 0.6598
550 W B 1.0085
551 G B 0.1164
552 Q B -0.9383
553 G B -0.7982
554 T B -0.6307
555 M B -0.2057
556 V B 0.1040
557 T B -0.0880
558 V B 0.0000
559 S B 0.0000
560 S B -0.3400
561 A B -0.4351
562 S B -0.7331
563 T B 0.0000
564 K B -1.7127
565 G B -0.9343
566 P B 0.0000
567 S B -0.1193
568 V B 0.0000
569 F B 0.4703
570 P B 0.0000
571 L B -0.3325
572 A B -0.3160
573 P B -0.3965
574 S B -0.5196
575 S B -1.3825
576 K B -1.9562
577 S B -1.6160
578 T B -0.6824
579 S B -0.9689
580 G B -1.4589
581 G B -1.0870
582 T B -0.6308
583 A B -0.1951
584 A B 0.0000
585 L B 0.0000
586 G B 0.0000
587 C B 0.0000
588 L B 0.0000
589 V B 0.0000
590 K B 0.0000
591 D B -0.4887
592 Y B 0.0000
593 F B 0.0000
594 P B 0.0000
595 E B -0.3175
596 P B -0.6948
597 V B -0.6913
598 T B -0.6183
599 V B -0.2620
600 S B -0.4294
601 W B 0.0000
602 N B -0.7910
603 S B -0.6976
604 G B -0.5867
605 A B -0.2657
606 L B 0.0013
607 T B -0.1830
608 S B -0.2044
609 G B -0.2750
610 V B 0.1207
611 H B -0.2905
612 T B -0.0737
613 F B 0.0000
614 P B -0.3245
615 A B 0.0586
616 V B 0.4850
617 L B 1.0297
618 Q B 0.2913
619 S B -0.0886
620 S B -0.1925
621 G B 0.0000
622 L B -0.0984
623 Y B 0.2257
624 S B 0.0000
625 L B 0.0000
626 S B 0.0000
627 S B 0.0000
628 V B 0.0000
629 V B 0.0000
630 T B -0.2319
631 V B 0.0000
632 P B -0.4836
633 S B -0.6246
634 S B -0.7051
635 S B -0.7831
636 L B -1.2403
637 G B -1.7116
638 T B -0.9353
639 Q B -1.6407
640 T B -1.3922
641 Y B 0.0000
642 I B -1.5921
643 C B 0.0000
644 N B -1.5135
645 V B 0.0000
646 N B -2.1177
647 H B 0.0000
648 K B -2.8005
649 P B -1.9703
650 S B -2.1946
651 N B -2.7165
652 T B -2.4414
653 K B -2.9530
654 V B -2.0289
655 D B -2.8028
656 K B -2.6832
657 K B -3.1129
658 V B 0.0000
659 E B -3.2164
660 P B -2.5982
661 K B -2.6528
662 S B -1.7239
663 C B -0.9254
664 D B -2.3786
665 K B -2.8779
666 T B -1.9243
667 H B -1.3997
668 T B -0.6097
669 C B 0.2269
670 P B -0.0472
671 P B -0.0744
672 C B 0.3116
673 P B -0.4479
674 A B -0.5099
675 P B -0.6756
676 E B -0.6183
677 L B 1.4828
678 L B 1.2478
679 G B 0.1627
680 G B -0.4710
681 P B 0.0000
682 S B -0.0704
683 V B 0.0000
684 F B 1.0100
685 L B 0.0000
686 F B 1.3436
687 P B 0.0221
688 P B 0.0000
689 K B -2.1929
690 P B -1.3639
691 K B -1.3630
692 D B 0.0000
693 T B 0.0000
694 L B -0.3500
695 M B 0.5381
696 I B 1.4415
697 S B -0.0769
698 R B -1.6201
699 T B -0.8030
700 P B 0.0000
701 E B -0.7381
702 V B 0.0000
703 T B 0.3447
704 C B 0.0000
705 V B 0.0000
706 V B 0.0000
707 V B -0.9419
708 D B -2.3418
709 V B 0.0000
710 S B -1.5965
711 H B -1.9819
712 E B -1.5013
713 D B 0.0000
714 P B -2.1417
715 E B -2.5968
716 V B -1.8048
717 K B -2.0475
718 F B -1.3752
719 N B -1.4091
720 W B 0.0000
721 Y B -1.0687
722 V B -1.1309
723 D B -2.2607
724 G B -1.0379
725 V B 0.1925
726 E B -1.5166
727 V B -0.9711
728 H B -1.9158
729 N B -2.2831
730 A B -1.7573
731 K B -2.4721
732 T B -1.9910
733 K B -2.5494
734 P B -2.4717
735 R B -3.5796
736 E B -3.8631
737 E B -3.7966
738 Q B -2.4582
739 Y B -0.3695
740 N B -1.4461
741 S B -1.4681
742 T B -2.3399
743 Y B 0.0000
744 R B -2.7738
745 V B 0.0000
746 V B -1.0075
747 S B 0.0000
748 V B 0.0000
749 L B 0.0000
750 T B -0.5292
751 V B 0.0000
752 L B 0.3729
753 H B -0.2884
754 Q B -1.4502
755 D B -1.3761
756 W B 0.0000
757 L B -0.9739
758 N B -2.1446
759 G B -2.1421
760 K B -2.2958
761 E B -2.3142
762 Y B 0.0000
763 K B -1.8405
764 C B 0.0000
765 K B -1.6117
766 V B 0.0000
767 S B -1.2895
768 N B 0.0000
769 K B -1.6988
770 A B -1.0019
771 L B -0.0318
772 P B -0.2755
773 A B -0.5271
774 P B -0.7757
775 I B -0.6975
776 E B -2.1220
777 K B -1.2553
778 T B -1.0071
779 I B -0.2237
780 S B -1.1754
781 K B -1.2573
782 A B -1.2057
783 K B -2.3929
784 G B -2.0780
785 Q B -2.3291
786 P B -2.1354
787 R B -2.6194
788 E B -3.0121
789 P B 0.0000
790 Q B -1.4854
791 V B -0.9195
792 Y B 0.0000
793 T B 0.0000
794 L B 0.0000
795 P B -0.3728
796 P B 0.0000
797 S B -1.5520
798 R B -2.8417
799 E B -2.9168
800 E B 0.0000
801 M B -2.1678
802 T B -1.9253
803 K B -2.8252
804 N B -2.7559
805 Q B -2.6676
806 V B 0.0000
807 S B 0.0000
808 L B 0.0000
809 T B 0.0000
810 C B 0.0000
811 L B 0.0000
812 V B 0.0000
813 K B -0.7668
814 G B -1.3347
815 F B 0.0000
816 Y B -1.3146
817 P B 0.0000
818 S B -0.2544
819 D B -0.9418
820 I B -0.5628
821 A B 0.0000
822 V B 0.0000
823 E B -1.0248
824 W B 0.0000
825 E B -1.6795
826 S B 0.0000
827 N B -1.8835
828 G B -1.8839
829 Q B -2.3277
830 P B -1.9672
831 E B -1.9639
832 N B -2.0213
833 N B -1.3045
834 Y B -0.8352
835 K B -0.7490
836 T B -0.2902
837 T B 0.0000
838 P B -0.2071
839 P B -0.0507
840 V B 0.0000
841 L B 0.2245
842 D B -0.9416
843 S B -1.3173
844 D B -2.0032
845 G B -1.0652
846 S B 0.0000
847 F B -0.1879
848 F B 0.0000
849 L B 0.0000
850 Y B 0.0000
851 S B 0.0000
852 K B 0.0000
853 L B 0.0000
854 T B -0.8545
855 V B 0.0000
856 D B -2.6498
857 K B -3.1000
858 S B -2.8025
859 R B -3.1013
860 W B 0.0000
861 Q B -2.6993
862 Q B -2.5435
863 G B -1.3711
864 N B -1.0121
865 V B 0.3065
866 F B 0.0000
867 S B -0.7295
868 C B 0.0000
869 S B 0.0000
870 V B 0.0000
871 M B -0.5327
872 H B 0.0000
873 E B -1.2269
874 A B -1.8466
875 L B 0.0000
876 H B -2.0464
877 N B -1.9392
878 H B -1.5931
879 Y B -0.6040
880 T B -0.8658
881 Q B -1.1749
882 K B -0.9985
883 S B -0.3640
884 L B 0.0000
885 S B -0.1472
886 L B -0.3357
887 S B -0.3928
888 P B -0.8700
889 G B -1.4236
890 K B -1.9863
891 Q C -1.2263
892 S C -0.4622
893 V C 0.5560
894 L C 0.0000
895 T C -0.0155
896 Q C -0.2962
897 P C -0.5296
898 P C -0.5617
899 S C -0.6199
900 V C -0.2900
901 S C -0.3613
902 G C 0.0000
903 A C -0.8701
904 P C -1.5121
905 G C -1.7721
906 Q C -2.3874
907 R C -2.6583
908 V C 0.0000
909 T C -0.6271
910 I C 0.0000
911 S C -0.3555
912 C C 0.0000
913 S C -0.4076
914 G C 0.0000
915 S C -0.9700
916 R C -1.9762
917 S C -1.7191
918 N C -1.9980
919 I C -1.3353
920 G C -1.1702
921 S C -0.4987
922 N C -0.6123
923 T C 0.0000
924 V C 0.0000
925 K C -0.1117
926 W C 0.0000
927 Y C 0.0000
928 Q C 0.0000
929 Q C -0.6991
930 L C -0.4820
931 P C -0.4427
932 G C -0.7490
933 T C -0.7292
934 A C -0.6271
935 P C 0.0000
936 K C -0.4919
937 L C -0.0696
938 L C 0.0000
939 I C 0.0000
940 Y C -0.0742
941 Y C 0.4629
942 N C 0.0000
943 D C -1.6925
944 Q C -1.8296
945 R C -2.3471
946 P C 0.0000
947 S C -0.4731
948 G C -0.7007
949 V C -1.0044
950 P C -1.3326
951 D C -2.2394
952 R C -1.6586
953 F C 0.0000
954 S C -1.3699
955 G C 0.0000
956 S C -0.7666
957 K C -0.7421
958 S C -0.9837
959 G C -1.2921
960 T C -1.1102
961 S C -0.7853
962 A C 0.0000
963 S C -0.4818
964 L C 0.0000
965 A C -0.5526
966 I C 0.0000
967 T C -1.5570
968 G C -1.7027
969 L C 0.0000
970 Q C -2.0863
971 A C -1.3968
972 E C -2.1487
973 D C 0.0000
974 E C -1.1983
975 A C 0.0000
976 D C -0.9494
977 Y C 0.0000
978 Y C 0.0000
979 C C 0.0000
980 Q C 0.0000
981 S C 0.3032
982 Y C -0.0674
983 D C -0.9814
984 R C -1.2392
985 Y C 0.1459
986 T C -0.4785
987 H C -1.4000
988 P C -0.9677
989 A C -0.6851
990 L C 0.0000
991 L C 0.1943
992 F C 0.0000
993 G C 0.0000
994 T C -0.5962
995 G C -0.6924
996 T C 0.0000
997 K C -1.1778
998 V C 0.0000
999 T C 0.0000
1000 V C -0.6159
1001 L C -0.2451
1002 G C -0.4293
1003 Q C -1.1516
1004 P C -1.3433
1005 K C -2.3218
1006 A C -1.3717
1007 A C -0.8756
1008 P C -0.7351
1009 S C -0.5057
1010 V C 0.0000
1011 T C -0.2968
1012 L C 0.0000
1013 F C 0.0000
1014 P C -0.0957
1015 P C 0.0000
1016 S C 0.0000
1017 S C -0.9561
1018 E C -1.5210
1019 E C 0.0000
1020 L C -1.6775
1021 Q C -1.9918
1022 A C -1.5705
1023 N C -2.5840
1024 K C -2.1959
1025 A C 0.0000
1026 T C 0.0000
1027 L C 0.0000
1028 V C 0.0000
1029 C C 0.0000
1030 L C 0.0000
1031 I C 0.0000
1032 S C -0.3269
1033 D C -0.7882
1034 F C 0.0000
1035 Y C -1.2132
1036 P C -1.0663
1037 G C -0.5004
1038 A C -0.2508
1039 V C -0.0519
1040 T C -0.2089
1041 V C -0.2970
1042 A C -0.4807
1043 W C 0.0000
1044 K C -1.2792
1045 A C -1.6239
1046 D C -2.3105
1047 S C -1.4467
1048 S C -1.0960
1049 P C -0.8868
1050 V C -0.6563
1051 K C -1.5001
1052 A C -0.8886
1053 G C -0.8646
1054 V C -0.7231
1055 E C -1.6267
1056 T C -0.8107
1057 T C -0.5819
1058 T C -0.3716
1059 P C -0.6800
1060 S C -0.8981
1061 K C -1.5399
1062 Q C -1.7846
1063 S C -1.4658
1064 N C -1.8071
1065 N C 0.0000
1066 K C -1.4053
1067 Y C 0.0000
1068 A C 0.0000
1069 A C 0.0000
1070 S C 0.0000
1071 S C 0.0000
1072 Y C 0.0000
1073 L C 0.0000
1074 S C -0.4367
1075 L C -1.1496
1076 T C -1.8935
1077 P C 0.0000
1078 E C -3.2763
1079 Q C -2.7011
1080 W C 0.0000
1081 K C -3.1656
1082 S C -2.6218
1083 H C -2.8568
1084 R C -2.9430
1085 S C -1.9452
1086 Y C 0.0000
1087 S C -0.9322
1088 C C 0.0000
1089 Q C -0.8344
1090 V C 0.0000
1091 T C -0.8080
1092 H C 0.0000
1093 E C -2.1156
1094 G C -1.3830
1095 S C -0.8544
1096 T C -0.0683
1097 V C 0.4616
1098 E C -1.3744
1099 K C -1.4840
1100 T C -0.8951
1101 V C 0.0000
1102 A C -0.4595
1103 P C -0.6404
1104 T C -1.0871
1105 E C -1.3381
1106 C C -0.1098
1107 S C -0.2482
1108 Q D -1.0884
1109 S D -0.3854
1110 V D 0.9994
1111 L D 0.0000
1112 T D 0.1720
1113 Q D 0.0000
1114 P D -0.5173
1115 P D -0.6085
1116 S D -0.6748
1117 V D -0.3299
1118 S D -0.4194
1119 G D 0.0000
1120 A D -1.1764
1121 P D -1.5225
1122 G D -1.7029
1123 Q D -2.2834
1124 R D -2.6060
1125 V D 0.0000
1126 T D -0.5566
1127 I D 0.0000
1128 S D -0.3260
1129 C D 0.0000
1130 S D -0.4187
1131 G D -0.6440
1132 S D -0.9977
1133 R D -2.3755
1134 S D -1.9934
1135 N D -1.9936
1136 I D 0.0000
1137 G D -1.3106
1138 S D -0.8873
1139 N D -0.9045
1140 T D 0.0000
1141 V D 0.0000
1142 K D 0.0000
1143 W D 0.0000
1144 Y D 0.0000
1145 Q D 0.0000
1146 Q D 0.0000
1147 L D 0.0777
1148 P D -0.1127
1149 G D -0.6604
1150 T D -0.7522
1151 A D -1.1251
1152 P D -1.0980
1153 K D -1.5905
1154 L D 0.0000
1155 L D 0.0000
1156 I D 0.0000
1157 Y D -0.5977
1158 Y D -0.4621
1159 N D 0.0000
1160 D D -2.5359
1161 Q D -2.2834
1162 R D -2.6260
1163 P D -1.4453
1164 S D -0.8577
1165 G D -0.9125
1166 V D -1.1448
1167 P D -1.3416
1168 D D -2.2506
1169 R D -1.6568
1170 F D 0.0000
1171 S D -1.4950
1172 G D 0.0000
1173 S D -1.0597
1174 K D -0.8811
1175 S D -1.0184
1176 G D -1.2617
1177 T D -1.2633
1178 S D -0.8055
1179 A D 0.0000
1180 S D -0.5594
1181 L D 0.0000
1182 A D -0.5383
1183 I D 0.0000
1184 T D -1.4845
1185 G D -1.5492
1186 L D 0.0000
1187 Q D -1.8574
1188 A D -1.4747
1189 E D -2.1562
1190 D D 0.0000
1191 E D -1.0653
1192 A D 0.0000
1193 D D -0.4628
1194 Y D 0.0000
1195 Y D -0.0514
1196 C D 0.0000
1197 Q D 0.0000
1198 S D 0.0000
1199 Y D 0.0000
1200 D D -0.4617
1201 R D -0.5502
1202 Y D 0.4273
1203 T D -0.0816
1204 H D -0.8615
1205 P D 0.0000
1206 A D -0.4247
1207 L D -0.2161
1208 L D 0.4217
1209 F D 0.5260
1210 G D 0.0000
1211 T D -0.2801
1212 G D -0.4588
1213 T D 0.0000
1214 K D -1.1746
1215 V D 0.0000
1216 T D -0.4601
1217 V D 0.0000
1218 L D -0.4370
1219 G D -0.5380
1220 Q D 0.0000
1221 P D -1.3895
1222 K D -2.1320
1223 A D 0.0000
1224 A D -0.6013
1225 P D -0.6491
1226 S D -0.0488
1227 V D 0.1103
1228 T D 0.2728
1229 L D 0.0000
1230 F D 0.1236
1231 P D -0.1509
1232 P D 0.0000
1233 S D -1.2969
1234 S D -1.6795
1235 E D -2.5310
1236 E D -1.8844
1237 L D -2.0403
1238 Q D -2.2348
1239 A D -1.7218
1240 N D -2.3152
1241 K D -1.7931
1242 A D 0.0000
1243 T D -0.1412
1244 L D 0.0000
1245 V D 0.0000
1246 C D 0.0000
1247 L D 0.0000
1248 I D 0.0000
1249 S D -0.2972
1250 D D -0.7277
1251 F D 0.0000
1252 Y D 0.0000
1253 P D -0.9114
1254 G D -0.3904
1255 A D -0.1587
1256 V D -0.0600
1257 T D -0.1887
1258 V D -0.1387
1259 A D -0.3317
1260 W D 0.0000
1261 K D -1.0849
1262 A D 0.0000
1263 D D -1.7082
1264 S D -1.0764
1265 S D -0.8543
1266 P D -0.7949
1267 V D -0.8085
1268 K D -1.5616
1269 A D -0.8338
1270 G D -0.6650
1271 V D -0.3915
1272 E D -1.4755
1273 T D -0.7742
1274 T D -0.5374
1275 T D -0.4165
1276 P D -0.7648
1277 S D -1.0627
1278 K D -1.8341
1279 Q D -2.0969
1280 S D -1.4719
1281 N D -1.3754
1282 N D 0.0000
1283 K D 0.0000
1284 Y D -0.4023
1285 A D 0.0000
1286 A D 0.0000
1287 S D 0.0000
1288 S D 0.0000
1289 Y D 0.0000
1290 L D 0.0000
1291 S D -0.1964
1292 L D -0.8845
1293 T D -1.7493
1294 P D 0.0000
1295 E D -3.0707
1296 Q D -2.4729
1297 W D 0.0000
1298 K D -3.0273
1299 S D -2.4538
1300 H D -2.3814
1301 R D -2.6718
1302 S D -1.5843
1303 Y D 0.0000
1304 S D -0.4386
1305 C D 0.0000
1306 Q D -0.6239
1307 V D 0.0000
1308 T D -0.9272
1309 H D 0.0000
1310 E D -2.3440
1311 G D -1.5992
1312 S D -0.9583
1313 T D -0.5686
1314 V D -0.5733
1315 E D -1.6409
1316 K D -0.9699
1317 T D -0.3379
1318 V D 0.5560
1319 A D 0.1305
1320 P D -0.1550
1321 T D -0.7462
1322 E D -1.2102
1323 C D -0.1602
1324 S D -0.0717

 

Laboratory of Theory of Biopolymers 2015