Project name: 3DWT_full_stat

Status: done

submitted: 2017-09-14 09:34:38, status changed: 2017-09-14 09:46:32
Settings
Chain sequence(s) A: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
C: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
B: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
E: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
D: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
G: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
F: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
H: VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.3872
Maximal score value
1.1673
Average score
-0.7405
Total score value
-739.7918

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 V A 0.3938
3 Q A -0.5094
4 L A 0.0000
5 V A 0.7515
6 E A 0.0623
7 S A -0.1907
8 G A -0.8708
9 G A -0.8741
10 G A -0.7785
11 S A -0.7470
12 V A -0.7495
13 Q A -1.7097
14 A A -1.5779
15 G A -1.2372
16 G A 0.0000
17 S A 0.0000
18 L A 0.0000
19 R A -0.7278
20 L A 0.0000
21 S A -0.1825
22 C A 0.0000
23 T A -0.4288
24 A A -0.3109
25 S A -0.2814
26 G A -0.5978
27 G A -0.7096
28 S A -0.3930
31 S A -0.6994
32 Y A 0.0000
33 S A -0.8450
34 T A -0.4906
35 F A 0.0000
36 S A 0.0000
37 L A 0.0000
38 G A 0.0000
39 W A 0.0000
40 F A 0.0000
41 R A 0.0000
42 Q A -1.8842
43 A A -1.7460
44 P A -1.2371
45 G A -1.7358
46 Q A -2.7997
47 E A -3.2562
48 R A -2.5481
49 E A -2.1278
50 A A -0.7467
51 V A 0.0000
52 A A 0.0000
53 A A 0.0000
54 I A 0.0000
55 A A 0.0000
56 S A 0.0000
57 M A 0.0000
58 G A -0.6314
59 G A -0.3703
60 L A -0.2341
61 T A -0.1444
62 Y A -0.4226
63 Y A -0.9743
64 A A -1.2850
65 D A -2.4298
66 S A -1.8371
67 V A 0.0000
68 K A -2.5708
69 G A -1.8545
70 R A -1.4507
71 F A 0.0000
72 T A -0.5669
73 I A 0.0000
74 S A -0.5696
75 R A -1.3749
76 D A -2.0390
77 N A -2.3900
78 A A -1.7778
79 K A -2.5435
80 N A -2.0657
81 T A -1.2906
82 V A 0.0000
83 T A -0.4002
84 L A 0.0000
85 Q A 0.0000
86 M A 0.0000
87 N A -1.2512
88 N A -1.8276
89 L A 0.0000
90 K A -2.3960
91 P A -1.8395
92 E A -2.3238
93 D A 0.0000
94 T A -1.1382
95 A A 0.0000
96 I A -0.6025
97 Y A 0.0000
98 Y A -0.3281
99 C A 0.0000
100 A A 0.0000
101 A A 0.0000
102 V A 0.0000
103 R A -0.9976
104 G A 0.0000
105 Y A 0.0000
106 F A 0.0000
107 M A -0.7286
108 R A -1.5757
109 L A -0.2811
110 P A 0.0000
111 S A -0.8536
112 S A -1.0772
113 H A -1.3897
114 N A -1.0582
115 F A 0.0000
116 R A -1.6817
117 Y A -0.5510
118 W A -0.2271
119 G A -0.3555
120 Q A -1.0208
121 G A -0.6806
122 T A 0.0000
123 Q A -1.2734
124 V A 0.0000
125 T A -1.0072
126 V A 0.0000
127 S A -1.1819
128 S A -0.8266
2 V B 0.0733
3 Q B -0.6453
4 L B 0.0000
5 V B 0.6288
6 E B -0.0053
7 S B -0.2616
8 G B -0.8470
9 G B -0.8314
10 G B -0.7644
11 S B -0.7796
12 V B -0.8227
13 Q B -1.6786
14 A B -1.5313
15 G B -1.3831
16 G B 0.0000
17 S B 0.0000
18 L B 0.0000
19 R B -0.6792
20 L B 0.0000
21 S B -0.2055
22 C B 0.0000
23 T B -0.6031
24 A B -0.5008
25 S B -0.5973
26 G B -0.7429
27 G B -0.6762
28 S B -0.4100
31 S B -0.6723
32 Y B 0.0000
33 S B -0.8895
34 T B 0.0000
35 F B -0.5512
36 S B 0.0000
37 L B 0.0000
38 G B 0.0000
39 W B 0.0000
40 F B 0.0000
41 R B 0.0000
42 Q B -1.5179
43 A B -1.4245
44 P B -1.0045
45 G B -1.3709
46 Q B -1.9995
47 E B -2.8239
48 R B -2.2563
49 E B -1.6400
50 A B -0.5890
51 V B 0.0000
52 A B 0.0000
53 A B 0.0000
54 I B 0.0000
55 A B 0.0000
56 S B 0.0000
57 M B 0.0000
58 G B -0.5810
59 G B -0.3624
60 L B -0.2093
61 T B -0.1624
62 Y B -0.4732
63 Y B -1.0096
64 A B -1.2543
65 D B -2.4496
66 S B -1.8343
67 V B 0.0000
68 K B -2.5895
69 G B -1.8577
70 R B -1.4435
71 F B 0.0000
72 T B -0.5540
73 I B 0.0000
74 S B -0.5660
75 R B -1.3795
76 D B -2.0459
77 N B -2.3482
78 A B -1.7786
79 K B -2.5249
80 N B -2.0163
81 T B -1.2878
82 V B 0.0000
83 T B -0.4037
84 L B 0.0000
85 Q B 0.0000
86 M B 0.0000
87 N B -1.2439
88 N B -1.7274
89 L B 0.0000
90 K B -2.3588
91 P B -1.9340
92 E B -2.3043
93 D B 0.0000
94 T B -1.1217
95 A B 0.0000
96 I B -0.5059
97 Y B 0.0000
98 Y B -0.2808
99 C B 0.0000
100 A B 0.0000
101 A B 0.0000
102 V B 0.0000
103 R B -1.3339
104 G B 0.0000
105 Y B 0.0000
106 F B 0.0000
107 M B -0.7316
108 R B -1.6690
109 L B -0.3840
110 P B -0.6520
111 S B -0.9154
112 S B -0.9265
113 H B -1.3150
114 N B -1.0373
115 F B 0.0000
116 R B -0.8494
117 Y B -0.1303
118 W B 0.0239
119 G B -0.3164
120 Q B -1.0294
121 G B -0.6545
122 T B 0.0000
123 Q B -1.2236
124 V B 0.0000
125 T B -1.0034
126 V B 0.0000
127 S B -1.1834
128 S B -0.7987
2 V C 0.2917
3 Q C -0.5800
4 L C 0.0000
5 V C 0.6685
6 E C -0.0935
7 S C -0.4251
8 G C -1.2431
9 G C -1.1211
10 G C -0.7901
11 S C -0.7055
12 V C -0.6425
13 Q C -1.6512
14 A C -1.4683
15 G C -1.2349
16 G C 0.0000
17 S C 0.0000
18 L C 0.0000
19 R C -1.1444
20 L C 0.0000
21 S C -0.3870
22 C C 0.0000
23 T C -0.4214
24 A C -0.3195
25 S C -0.5581
26 G C -0.6822
27 G C -0.6438
28 S C -0.4249
31 S C -0.7619
32 Y C 0.0000
33 S C -0.9901
34 T C -0.5751
35 F C 0.0000
36 S C 0.0000
37 L C 0.0000
38 G C 0.0000
39 W C 0.0000
40 F C 0.0000
41 R C 0.0000
42 Q C -1.9475
43 A C -1.7797
44 P C -1.2417
45 G C -1.7504
46 Q C -2.8211
47 E C -3.2962
48 R C -2.6299
49 E C -2.2193
50 A C -1.0268
51 V C 0.0000
52 A C 0.0000
53 A C 0.0000
54 I C 0.0000
55 A C 0.0000
56 S C 0.0000
57 M C 0.0000
58 G C -0.7376
59 G C -0.4801
60 L C -0.1870
61 T C -0.1319
62 Y C -0.4726
63 Y C -0.9695
64 A C -1.3824
65 D C -2.4192
66 S C -1.8400
67 V C 0.0000
68 K C -2.5602
69 G C -1.8345
70 R C -1.4638
71 F C 0.0000
72 T C -0.6427
73 I C 0.0000
74 S C -0.5487
75 R C -1.4067
76 D C -2.0175
77 N C -2.4111
78 A C -1.7729
79 K C -2.5318
80 N C -2.0552
81 T C -1.2976
82 V C 0.0000
83 T C -0.5140
84 L C 0.0000
85 Q C -0.7614
86 M C 0.0000
87 N C -1.2838
88 N C -1.6995
89 L C 0.0000
90 K C -2.1944
91 P C -1.8479
92 E C -2.2752
93 D C 0.0000
94 T C -1.1308
95 A C 0.0000
96 I C -0.5789
97 Y C 0.0000
98 Y C -0.3435
99 C C 0.0000
100 A C 0.0000
101 A C 0.0000
102 V C 0.0000
103 R C -1.6650
104 G C 0.0000
105 Y C 0.0000
106 F C 0.0000
107 M C -0.9353
108 R C -1.6116
109 L C -0.4953
110 P C 0.0000
111 S C -1.0225
112 S C -1.1551
113 H C -1.5217
114 N C 0.0000
115 F C 0.0000
116 R C -1.6394
117 Y C -0.6819
118 W C -0.1965
119 G C -0.3780
120 Q C -1.0279
121 G C 0.0000
122 T C -0.9630
123 Q C -1.2865
124 V C 0.0000
125 T C -0.9758
126 V C 0.0000
127 S C -1.1607
128 S C -0.8053
2 V D 0.1117
3 Q D -0.5698
4 L D 0.0000
5 V D 1.1673
6 E D 0.1922
7 S D -0.2543
8 G D -1.0033
9 G D -0.9402
10 G D -0.7391
11 S D -0.7154
12 V D -0.7229
13 Q D -1.7898
14 A D -1.5990
15 G D -1.4328
16 G D 0.0000
17 S D 0.0000
18 L D 0.0000
19 R D -0.9413
20 L D 0.0000
21 S D -0.2345
22 C D 0.0000
23 T D -0.2117
24 A D -0.3262
25 S D -0.2949
26 G D -0.7505
27 G D -0.6552
28 S D -0.3778
32 Y D -0.7210
33 S D -0.7757
34 T D -0.3311
35 F D 0.0000
36 S D 0.0000
37 L D 0.0000
38 G D 0.0000
39 W D 0.0000
40 F D 0.0000
41 R D 0.0000
42 Q D -1.7192
43 A D -1.5465
44 P D -1.0703
45 G D -1.4380
46 Q D -2.0909
47 E D -2.8889
48 R D -2.3261
49 E D -1.6874
50 A D -0.6401
51 V D 0.0000
52 A D 0.0000
53 A D 0.0000
54 I D 0.0000
55 A D 0.0000
56 S D 0.0000
57 M D -0.0841
58 G D -0.6631
59 G D -0.2758
60 L D -0.1280
61 T D -0.0807
62 Y D -0.4299
63 Y D -0.9999
64 A D -1.3346
65 D D -2.4278
66 S D -1.8438
67 V D 0.0000
68 K D -2.5770
69 G D -1.8616
70 R D -1.5220
71 F D 0.0000
72 T D -0.6434
73 I D 0.0000
74 S D -0.5516
75 R D -1.4006
76 D D -1.9817
77 N D -2.3099
78 A D -1.7235
79 K D -2.4588
80 N D -1.9053
81 T D -1.1918
82 V D 0.0000
83 T D -0.4829
84 L D 0.0000
85 Q D -0.6981
86 M D 0.0000
87 N D -1.3572
88 N D -1.9245
89 L D 0.0000
90 K D -2.5931
91 P D -1.9191
92 E D -2.3914
93 D D 0.0000
94 T D -1.2079
95 A D 0.0000
96 I D -0.6331
97 Y D 0.0000
98 Y D -0.2179
99 C D 0.0000
100 A D 0.0000
101 A D 0.0000
102 V D 0.0000
103 R D -1.0970
104 G D 0.0000
105 Y D 0.0000
106 F D 0.0000
107 M D -0.6536
108 R D -1.3233
109 L D -0.4098
110 P D 0.0000
111 S D -1.1080
112 S D -1.0951
113 H D -1.7158
114 N D -1.4431
115 F D 0.0000
116 R D -1.4222
117 Y D -0.4868
118 W D -0.1098
119 G D 0.0000
120 Q D -0.9374
121 G D -0.6632
122 T D -0.9582
123 Q D -1.2762
124 V D 0.0000
125 T D -1.0137
126 V D 0.0000
127 S D -1.2142
128 S D -0.8392
2 V E -0.1779
3 Q E -0.6805
4 L E 0.0000
5 V E 0.8506
6 E E -0.1211
7 S E -0.5444
8 G E -1.4124
9 G E -1.2999
10 G E -0.9397
11 S E -0.6560
12 V E -0.5100
13 Q E -1.2333
14 A E 0.0000
15 G E 0.0000
16 G E 0.0000
17 S E -0.9489
18 L E -1.0556
19 R E -2.1758
20 L E 0.0000
21 S E -0.6270
22 C E 0.0000
23 T E -0.3802
24 A E -0.3736
25 S E -0.4323
26 G E -0.7924
27 G E -0.7557
28 S E -0.4690
31 S E -0.8350
32 Y E 0.0000
33 S E -0.9205
34 T E -0.5618
35 F E -0.6693
36 S E 0.0000
37 L E 0.0000
38 G E 0.0000
39 W E 0.0000
40 F E 0.0000
41 R E 0.0000
42 Q E -1.8110
43 A E -1.5648
44 P E -1.0726
45 G E -1.4521
46 Q E -2.1332
47 E E -2.9920
48 R E -2.5466
49 E E -1.8037
50 A E -0.8889
51 V E 0.0000
52 A E 0.0000
53 A E 0.0000
54 I E 0.0000
55 A E 0.0000
56 S E 0.0000
57 M E 0.8775
58 G E -0.1769
59 G E -0.2531
60 L E 0.0540
61 T E -0.1343
62 Y E -0.5236
63 Y E -1.0402
64 A E -1.2824
65 D E -2.4393
66 S E -1.8486
67 V E 0.0000
68 K E -2.5905
69 G E -1.7175
70 R E -1.2666
71 F E 0.0000
72 T E -0.7105
73 I E 0.0000
74 S E -0.5948
75 R E -1.4320
76 D E -2.0402
77 N E -2.4098
78 A E -1.7846
79 K E -2.5469
80 N E -2.0884
81 T E -1.2949
82 V E 0.0000
83 T E -0.7513
84 L E 0.0000
85 Q E 0.0000
86 M E 0.0000
87 N E 0.0000
88 N E -0.8012
89 L E 0.0000
90 K E -1.5460
91 P E -1.5374
92 E E -2.1520
93 D E 0.0000
94 T E -1.0484
95 A E 0.0000
96 I E -0.5982
97 Y E 0.0000
98 Y E -0.3242
99 C E 0.0000
100 A E 0.0000
101 A E 0.0000
102 V E -1.2952
103 R E -2.1265
104 G E -0.9760
105 Y E -0.0286
106 F E -0.0581
107 M E -0.3970
108 R E -1.4848
109 L E -0.6291
110 P E 0.0000
111 S E -1.2286
112 S E -1.4565
113 H E -1.8943
114 N E -2.0459
115 F E 0.0000
116 R E -2.2402
117 Y E -0.8992
118 W E -0.2588
119 G E -0.3181
120 Q E -1.0053
121 G E -0.6960
122 T E 0.0000
123 Q E -1.3239
124 V E 0.0000
125 T E -0.8792
126 V E 0.0000
127 S E -0.9629
128 S E -0.6333
2 V F 0.4893
3 Q F -0.3482
4 L F 0.0000
5 V F 0.7260
6 E F -0.0564
7 S F -0.5559
8 G F -1.4094
9 G F -1.2672
10 G F -0.9022
11 S F -0.5698
12 V F -0.3697
13 Q F -1.0146
14 A F -1.1117
15 G F 0.0000
16 G F -0.5782
17 S F -0.9441
18 L F -1.0583
19 R F -2.1586
20 L F 0.0000
21 S F -0.6471
22 C F 0.0000
23 T F -0.4141
24 A F -0.2344
25 S F -0.4317
26 G F -0.5896
27 G F -0.5632
28 S F -0.3874
31 S F -0.8236
32 Y F 0.0000
33 S F -0.9766
34 T F -0.6255
35 F F -0.7147
36 S F 0.0000
37 L F 0.0000
38 G F 0.0000
39 W F 0.0000
40 F F 0.0000
41 R F 0.0000
42 Q F -1.8994
43 A F -1.7524
44 P F -1.2144
45 G F -1.7446
46 Q F -2.8219
47 E F -3.3073
48 R F -2.6478
49 E F -2.3551
50 A F -1.1105
51 V F 0.0000
52 A F 0.0000
53 A F 0.0000
54 I F 0.0000
55 A F 0.0000
56 S F 0.0000
57 M F 0.4377
58 G F -0.3447
59 G F 0.0263
60 L F -0.0972
61 T F -0.0853
62 Y F -0.5353
63 Y F -1.0742
64 A F -1.5596
65 D F -2.4478
66 S F -1.8410
67 V F 0.0000
68 K F -2.5865
69 G F -1.7099
70 R F -1.2688
71 F F 0.0000
72 T F -0.7137
73 I F 0.0000
74 S F -0.5598
75 R F -1.4016
76 D F -2.0361
77 N F -2.3953
78 A F -1.7868
79 K F -2.5398
80 N F -2.0519
81 T F -1.2924
82 V F 0.0000
83 T F -0.7640
84 L F 0.0000
85 Q F 0.0000
86 M F 0.0000
87 N F 0.0000
88 N F -0.9008
89 L F 0.0000
90 K F -1.8667
91 P F -1.6734
92 E F -2.2755
93 D F 0.0000
94 T F -1.0963
95 A F 0.0000
96 I F -0.5848
97 Y F 0.0000
98 Y F -0.3655
99 C F 0.0000
100 A F 0.0000
101 A F 0.0000
102 V F -1.4046
103 R F -2.0773
104 G F -0.8677
105 Y F -0.1794
106 F F -0.1640
107 M F -0.4279
108 R F -1.5466
109 L F -0.6538
110 P F 0.0000
111 S F -1.3370
112 S F -1.5123
113 H F -1.8687
114 N F -1.9616
115 F F 0.0000
116 R F -2.0649
117 Y F -0.6331
118 W F -0.1616
119 G F -0.3299
120 Q F -1.0384
121 G F -0.7152
122 T F 0.0000
123 Q F -1.3026
124 V F 0.0000
125 T F -0.8716
126 V F 0.0000
127 S F -0.9330
128 S F -0.6220
2 V G 0.4477
3 Q G -0.3932
4 L G 0.0000
5 V G 1.1242
6 E G 0.2126
7 S G -0.3906
8 G G -1.2663
9 G G -1.1640
10 G G -0.9194
11 S G -0.7515
12 V G -0.7405
13 Q G -1.6270
14 A G -1.4777
15 G G 0.0000
16 G G -0.8770
17 S G -0.9830
18 L G -0.9908
19 R G -1.8186
20 L G 0.0000
21 S G -0.4970
22 C G 0.0000
23 T G -0.4149
24 A G -0.3712
25 S G -0.2082
26 G G -0.6391
27 G G -0.6166
28 S G -0.4093
31 S G -0.8126
32 Y G 0.0000
33 S G -0.7797
34 T G -0.4614
35 F G -0.5660
36 S G 0.0000
37 L G 0.0000
38 G G 0.0000
39 W G 0.0000
40 F G 0.0000
41 R G 0.0000
42 Q G -2.0203
43 A G -1.8190
44 P G -1.2786
45 G G -1.7776
46 Q G -2.8646
47 E G -3.3872
48 R G -2.8482
49 E G -2.2709
50 A G -0.8711
51 V G 0.0000
52 A G 0.0000
53 A G 0.0000
54 I G 0.0000
55 A G 0.0000
56 S G 0.0000
57 M G 0.8801
58 G G -0.1023
59 G G -0.0691
60 L G -0.0513
61 T G -0.0957
62 Y G -0.4794
63 Y G -1.0121
64 A G -1.3821
65 D G -2.4451
66 S G -1.8486
67 V G 0.0000
68 K G -2.6043
69 G G -1.7399
70 R G -1.3181
71 F G 0.0000
72 T G -0.7186
73 I G 0.0000
74 S G -0.5991
75 R G -1.3949
76 D G -2.0229
77 N G -2.3805
78 A G -1.7869
79 K G -2.5189
80 N G -2.0307
81 T G -1.2390
82 V G 0.0000
83 T G -0.6992
84 L G 0.0000
85 Q G -0.8475
86 M G 0.0000
87 N G 0.0000
88 N G -1.0122
89 L G 0.0000
90 K G -1.9783
91 P G -1.7552
92 E G -2.2708
93 D G 0.0000
94 T G -1.1256
95 A G 0.0000
96 I G -0.7192
97 Y G 0.0000
98 Y G -0.3493
99 C G 0.0000
100 A G 0.0000
101 A G 0.0000
102 V G -1.4201
103 R G -2.0851
104 G G -0.7380
105 Y G 0.0129
106 F G -0.1401
107 M G -0.3729
108 R G -1.3837
109 L G -0.5733
110 P G 0.0000
111 S G -1.3310
112 S G -1.5483
113 H G -1.9283
114 N G -2.1233
115 F G 0.0000
116 R G -2.2906
117 Y G -0.7444
118 W G -0.1296
119 G G -0.2338
120 Q G -0.9755
121 G G -0.6513
122 T G -0.8134
123 Q G -1.3317
124 V G 0.0000
125 T G -1.0172
126 V G 0.0000
127 S G -1.1792
128 S G -0.7709
2 V H 0.3902
3 Q H -0.4143
4 L H 0.0000
5 V H 1.0511
6 E H -0.0016
7 S H -0.4911
8 G H -1.3943
9 G H -1.2792
10 G H -0.9591
11 S H -0.6795
12 V H -0.5833
13 Q H -1.2721
14 A H -1.2331
15 G H 0.0000
16 G H -0.7025
17 S H -0.9780
18 L H 0.0000
19 R H -1.8680
20 L H 0.0000
21 S H -0.5572
22 C H 0.0000
23 T H -0.3493
24 A H -0.2294
25 S H -0.2610
26 G H -0.6101
27 G H -0.5785
28 S H -0.3878
31 S H -0.7888
32 Y H 0.0000
33 S H -0.7539
34 T H -0.4610
35 F H -0.5230
36 S H 0.0000
37 L H 0.0000
38 G H 0.0000
39 W H 0.0000
40 F H 0.0000
41 R H 0.0000
42 Q H -1.9885
43 A H -1.7809
44 P H -1.2684
45 G H -1.7781
46 Q H -2.8412
47 E H -3.3495
48 R H -2.7343
49 E H -2.1585
50 A H -0.8180
51 V H 0.0000
52 A H 0.0000
53 A H 0.0000
54 I H 0.0000
55 A H 0.0000
56 S H 0.0000
57 M H 0.9153
58 G H 0.3051
59 G H 0.1693
60 L H 0.0332
61 T H -0.0164
62 Y H -0.4873
63 Y H -1.0561
64 A H -1.3703
65 D H -2.4532
66 S H -1.8441
67 V H 0.0000
68 K H -2.5894
69 G H -1.7120
70 R H -1.2754
71 F H 0.0000
72 T H -0.6860
73 I H 0.0000
74 S H -0.5686
75 R H -1.3668
76 D H -1.9714
77 N H -2.3419
78 A H -1.7771
79 K H -2.5064
80 N H -2.0465
81 T H -1.2538
82 V H 0.0000
83 T H -0.6887
84 L H 0.0000
85 Q H -0.8611
86 M H 0.0000
87 N H 0.0000
88 N H -0.9436
89 L H 0.0000
90 K H -1.8996
91 P H -1.7117
92 E H -2.2736
93 D H 0.0000
94 T H -1.1130
95 A H 0.0000
96 I H -0.6536
97 Y H 0.0000
98 Y H -0.3097
99 C H 0.0000
100 A H 0.0000
101 A H 0.0000
102 V H -1.4380
103 R H -2.0673
104 G H -0.7237
105 Y H -0.0392
106 F H -0.1501
107 M H -0.3612
108 R H -1.4509
109 L H -0.6529
110 P H 0.0000
111 S H -1.2888
112 S H -1.5023
113 H H -1.9313
114 N H -2.1458
115 F H 0.0000
116 R H -2.2952
117 Y H -0.7529
118 W H -0.1514
119 G H 0.0000
120 Q H -0.9198
121 G H -0.6521
122 T H 0.0000
123 Q H -1.3300
124 V H 0.0000
125 T H -0.9246
126 V H 0.0000
127 S H -1.0085
128 S H -0.6608

 

Laboratory of Theory of Biopolymers 2015