Project name: WT zmgg

Status: done

submitted: 2017-03-14 11:58:40, status changed: 2017-03-14 12:07:19
Settings
Chain sequence(s) A: SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9632
Maximal score value
1.2374
Average score
-0.9312
Total score value
-209.5257

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 S A -1.7529
3 K A -1.9422
4 G A 0.0000
5 E A -2.6716
6 E A -2.5949
7 L A -1.2087
8 F A 0.0000
9 T A -0.6353
10 G A 0.4437
11 V A 1.2374
12 V A 0.0000
13 P A -0.9706
14 I A 0.0000
15 L A -0.9837
16 V A 0.0000
17 E A -1.9112
18 L A 0.0000
19 D A -3.3257
20 G A 0.0000
21 D A -2.4254
22 V A 0.0000
23 N A -2.0488
24 G A -1.6208
25 H A -2.1592
26 K A -2.8439
27 F A 0.0000
28 S A -1.6626
29 V A 0.0000
30 S A -0.9609
31 G A 0.0000
32 E A -2.1395
33 G A -1.4828
34 E A -1.5481
35 G A 0.0000
36 D A 0.0545
37 A A 0.0000
38 T A 0.2706
39 Y A 0.9379
40 G A 0.0000
41 K A -0.3961
42 L A 0.0000
43 T A -0.7597
44 L A 0.0000
45 K A -0.9353
46 F A 0.0000
47 I A -1.0368
48 C A 0.0000
49 T A -0.7770
50 T A -1.2886
51 G A -1.5886
52 K A -2.2435
53 L A 0.0000
54 P A -1.2001
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0032
63 T A 0.0000
64 F A 0.0000
68 V A -0.0493
69 Q A -0.2122
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.1756
74 Y A 0.0000
75 P A -1.7948
76 D A -3.0601
77 H A -2.2778
78 M A 0.0000
79 K A -3.2977
80 R A -3.0432
81 H A -1.7551
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A -1.1575
86 S A 0.0000
87 A A 0.0000
88 M A 0.0000
89 P A -1.8368
90 E A -2.5025
91 G A 0.0000
92 Y A 0.0000
93 V A -0.9206
94 Q A 0.0000
95 E A -2.5839
96 R A 0.0000
97 T A -0.5137
98 I A 0.0000
99 F A 0.3820
100 F A 0.0000
101 K A -1.5422
102 D A -2.5269
103 D A -2.4637
104 G A 0.0000
105 N A -0.7187
106 Y A 0.0000
107 K A -1.8639
108 T A 0.0000
109 R A -3.1102
110 A A 0.0000
111 E A -2.2105
112 V A 0.0000
113 K A -1.9493
114 F A -1.9997
115 E A -2.7611
116 G A -2.2829
117 D A -2.5432
118 T A -1.7261
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.8389
123 I A 0.0000
124 E A -3.9370
125 L A 0.0000
126 K A -2.6728
127 G A 0.0000
128 I A -1.1456
129 D A -2.2764
130 F A 0.0000
131 K A -3.9070
132 E A -3.9632
133 D A -3.5886
134 G A -2.7831
135 N A -2.1312
136 I A 0.0000
137 L A -1.9112
138 G A -2.2781
139 H A -2.2231
140 K A -2.5221
141 L A 0.0000
142 E A -1.8579
143 Y A -0.6841
144 N A -0.6143
145 Y A -0.6998
146 N A -0.9671
147 S A -1.0622
148 H A 0.0000
149 N A -1.0832
150 V A 0.0000
151 Y A 0.0708
152 I A 0.0000
153 M A -0.9523
154 A A -1.7125
155 D A 0.0000
156 K A -3.1072
157 Q A -3.1298
158 K A -3.4495
159 N A -2.6418
160 G A 0.0000
161 I A 0.0000
162 K A -1.5354
163 V A 0.0000
164 N A -0.3741
165 F A 0.0000
166 K A -1.1709
167 I A 0.0000
168 R A -0.8516
169 H A 0.0000
170 N A -1.1589
171 I A 0.0000
172 E A -3.2768
173 D A -2.9819
174 G A -1.8037
175 S A -0.7053
176 V A 0.4138
177 Q A 0.0000
178 L A -0.3873
179 A A 0.0000
180 D A 0.0000
181 H A 0.0000
182 Y A 0.1672
183 Q A 0.0000
184 Q A -1.7701
185 N A 0.0000
186 T A -0.9746
187 P A -0.8383
188 I A -0.3974
189 G A -1.3280
190 D A -2.0285
191 G A -1.3737
192 P A -0.8354
193 V A -0.5723
194 L A -0.6519
195 L A -0.7839
196 P A 0.0000
197 D A -2.2067
198 N A -1.6170
199 H A 0.0000
200 Y A 0.1266
201 L A 0.0000
202 S A -0.6284
203 T A -0.8360
204 Q A -1.3153
205 S A -0.5634
206 A A -0.0183
207 L A -0.0132
208 S A -0.6479
209 K A -1.7200
210 D A -2.1748
211 P A -1.8365
212 N A -2.4828
213 E A -2.7275
214 K A -3.1984
215 R A -3.4003
216 D A -2.3069
217 H A 0.0000
218 M A 0.0000
219 V A -0.1259
220 L A 0.0000
221 L A 0.2786
222 E A -0.2545
223 F A -0.0486
224 V A 0.0000
225 T A -0.4479
226 A A 0.0000
227 A A 0.0867
228 G A 0.3071
229 I A 1.2046

 

Laboratory of Theory of Biopolymers 2015