Project name: 64b29d60ed2c832 [mutate: FB19D, WB23D]

Status: running

submitted: 2018-04-17 07:15:30, status changed: 2018-04-18 12:35:29
Settings
Chain sequence(s) B: LSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
Distance of aggregation 10 Å
Dynamic mode Yes
Mutated residues FB19D, WB23D
Energy difference between WT (input) and mutated protein (by FoldX) None kcal/mol

 

Laboratory of Theory of Biopolymers 2015