Project name: 663244ff0184704

Status: done

submitted: 2017-11-14 10:16:04, status changed: 2017-11-14 11:39:25
Settings
Chain sequence(s) A: DIQMTQSPSSLSASVGDRVTITCSPVQYLRWIWYWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIQMTQSPSSLSASVGDRVTITCSPVQYLRWIWYWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVESGGGAVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVILYDGSDKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVAVAGTHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7917
Maximal score value
1.6229
Average score
-0.7673
Total score value
-1015.9581

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.9868
2 I A 0.7125
3 Q A 0.0000
4 M A 0.7910
5 T A 0.0000
6 Q A -1.1877
7 S A -0.8162
8 P A -0.8679
9 S A -0.8054
10 S A -0.7097
11 L A -0.3874
12 S A -0.7748
13 A A 0.0000
14 S A -1.0938
15 V A 0.0315
16 G A -0.9872
17 D A -2.2203
18 R A -2.6179
19 V A 0.0000
20 T A -0.8209
21 I A 0.0000
22 T A -0.8033
23 C A 0.0000
24 S A -0.3542
25 P A 0.0000
26 V A 0.6884
27 Q A -0.7178
28 Y A -0.3103
29 L A 0.0000
30 R A -1.5960
31 W A -0.2804
32 I A 0.2469
33 W A 0.0000
34 Y A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A -1.4735
39 K A -2.3084
40 P A -1.7571
41 G A -1.8020
42 K A -2.6873
43 A A -1.6986
44 P A 0.0000
45 K A -0.7940
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.7993
50 A A 0.3293
51 A A 0.0442
52 S A 0.1685
53 S A 0.1361
54 L A 0.5115
55 Q A 0.1728
56 S A -0.1846
57 G A -0.3615
58 V A -0.0934
59 P A -0.3656
60 S A -0.3081
61 R A -0.6785
62 F A 0.0000
63 S A -0.1795
64 G A 0.0000
65 S A -0.5305
66 G A -1.0017
67 S A -0.8907
68 G A 0.0000
69 T A -0.9604
70 D A -1.7803
71 F A 0.0000
72 T A -0.7640
73 L A 0.0000
74 T A -0.5699
75 I A 0.0000
76 S A -1.4582
77 S A -1.2816
78 L A 0.0000
79 Q A -0.7213
80 P A -1.3541
81 E A -2.0231
82 D A 0.0000
83 F A -1.1140
84 A A 0.0000
85 T A -0.8190
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 L A -0.0057
92 N A -0.7185
93 S A -0.3606
94 Y A 0.4357
95 P A -0.1002
96 P A 0.0000
97 T A -0.1728
98 F A 0.0000
99 G A 0.0000
100 G A -0.8383
101 G A -0.9548
102 T A 0.0000
103 K A -1.0544
104 V A 0.0000
105 E A -1.1891
106 I A -1.2054
107 K A -1.7474
108 R A -2.1330
109 T A -0.4684
110 V A 0.8287
111 A A 0.2653
112 A A 0.0843
113 P A -0.1448
114 S A -0.2885
115 V A 0.0000
116 F A 0.1996
117 I A 0.0000
118 F A 0.0000
119 P A 0.0000
120 P A 0.0000
121 S A -1.7364
122 D A -3.1573
123 E A -3.2785
124 Q A 0.0000
125 L A 0.0000
126 K A -3.3791
127 S A -1.9033
128 G A -1.3730
129 T A -0.8928
130 A A 0.0000
131 S A 0.0000
132 V A 0.0000
133 V A 0.0000
134 C A 0.0000
135 L A 0.0000
136 L A 0.0000
137 N A 0.0000
138 N A -1.1216
139 F A 0.0000
140 Y A 0.0000
141 P A -1.8897
142 R A -3.2217
143 E A -3.3223
144 A A -2.5740
145 K A -2.5834
146 V A 0.0000
147 Q A -0.9741
148 W A 0.0000
149 K A -0.3556
150 V A -0.6243
151 D A -1.4258
152 N A -1.1778
153 A A -0.1856
154 L A 0.5280
155 Q A -0.8942
156 S A -0.7444
157 G A -1.2515
158 N A -1.9905
159 S A -1.5774
160 Q A -1.3533
161 E A -1.9145
162 S A -0.7209
163 V A -0.8557
164 T A -1.1839
165 E A -2.2590
166 Q A 0.0000
167 D A -2.8264
168 S A -2.5479
169 K A -3.0019
170 D A -3.3319
171 S A -2.9331
172 T A 0.0000
173 Y A 0.0000
174 S A 0.0000
175 L A 0.0000
176 S A 0.0000
177 S A 0.0000
178 T A 0.0000
179 L A 0.0000
180 T A -0.5045
181 L A -0.5701
182 S A -1.0220
183 K A -1.7918
184 A A -1.8969
185 D A -2.0724
186 Y A 0.0000
187 E A -2.7378
188 K A -3.1161
189 H A -2.7306
190 K A -2.8914
191 V A -1.5943
192 Y A 0.0000
193 A A -0.8413
194 C A 0.0000
195 E A -1.0038
196 V A 0.0000
197 T A -1.1919
198 H A 0.0000
199 Q A -1.7838
200 G A -0.3982
201 L A -0.0808
202 S A -0.3976
203 S A -0.3191
204 P A -0.4728
205 V A 0.0078
206 T A -0.4330
207 K A -0.6924
208 S A -0.7640
209 F A 0.0000
210 N A -2.1079
211 R A -2.2596
212 G A -1.6058
213 E A -1.5270
214 C A -1.3535
215 Q B -1.4574
216 V B -1.0530
217 Q B -1.4799
218 L B 0.0000
219 V B -0.2502
220 E B -0.2869
221 S B -0.6233
222 G B -0.7771
223 G B -0.4449
224 G B 0.0170
225 A B -0.2810
226 V B 0.0000
227 Q B -2.2067
228 P B -2.3015
229 G B -2.3638
230 R B -2.8317
231 S B -2.0274
232 L B -1.4372
233 R B -2.0206
234 L B 0.0000
235 S B -0.7103
236 C B 0.0000
237 A B -0.4935
238 A B -0.6932
239 S B -0.9655
240 G B -0.8190
241 F B -0.0416
242 T B -0.0378
243 F B 0.0000
244 S B -0.6213
245 S B 0.0817
246 Y B 0.6439
247 G B 0.0000
248 M B 0.0000
249 H B 0.0000
250 W B 0.0000
251 V B 0.0000
252 R B -0.5272
253 Q B -0.9103
254 A B -1.1630
255 P B -1.0949
256 G B -1.4863
257 K B -2.3582
258 G B -1.5530
259 L B -1.0131
260 E B -1.2877
261 W B 0.0000
262 V B 0.0000
263 A B 0.0000
264 V B 0.0000
265 I B 0.0000
266 L B -0.3108
267 Y B -0.2264
268 D B -1.7512
269 G B -1.5212
270 S B -1.5045
271 D B -2.0745
272 K B -1.0422
273 F B 0.1606
274 Y B -0.5501
275 A B -1.1855
276 D B -2.5980
277 S B -2.1861
278 V B 0.0000
279 K B -2.7591
280 G B -2.1395
281 R B -2.5143
282 F B 0.0000
283 T B -1.1910
284 I B 0.0000
285 S B -0.5980
286 R B -0.9614
287 D B -1.6748
288 N B -1.6660
289 S B -1.6106
290 K B -2.4299
291 N B -1.8488
292 T B -1.1028
293 L B 0.0000
294 Y B -0.5281
295 L B 0.0000
296 Q B -1.4654
297 M B 0.0000
298 N B -2.1141
299 S B -1.9616
300 L B 0.0000
301 R B -3.2198
302 A B -2.0734
303 E B -2.4956
304 D B 0.0000
305 T B -0.6925
306 A B 0.0000
307 V B 0.5282
308 Y B 0.0000
309 Y B 0.0000
310 C B 0.0000
311 A B 0.0000
312 K B 0.0000
313 V B 0.8149
314 A B 0.5924
315 V B 0.0000
316 A B 0.0000
317 G B 0.0000
318 T B -0.4608
319 H B -0.0104
320 F B 0.8046
321 D B 0.0000
322 Y B 0.0626
323 W B 0.0000
324 G B 0.0000
325 Q B -1.4912
326 G B -0.6063
327 T B 0.2058
328 L B 0.9995
329 V B 0.0000
330 T B -0.2125
331 V B 0.0000
332 S B -1.0763
333 S B -0.7858
334 A B -0.5875
335 S B -0.7542
336 T B -0.8403
337 K B -1.2792
338 G B -1.4836
339 P B -0.7856
340 S B -0.6258
341 V B 0.0000
342 F B -0.8199
343 P B -1.3639
344 L B 0.0000
345 A B -0.7693
346 P B -0.6197
347 S B -1.0130
348 S B -1.2985
349 K B -2.0453
350 S B -1.4858
351 T B -0.9487
352 S B -1.0001
353 G B -0.7679
354 G B -0.6933
355 T B -0.5078
356 A B -0.2824
357 A B 0.0000
358 L B 0.0000
359 G B 0.0000
360 C B 0.0000
361 L B 0.0000
362 V B 0.0000
363 K B -0.4340
364 D B -0.8893
365 Y B 0.0000
366 F B 0.0000
367 P B 0.0000
368 E B -0.4121
369 P B -0.6338
370 V B -0.6281
371 T B -0.5313
372 V B -0.3347
373 S B -0.2999
374 W B 0.0000
375 N B -0.7311
376 S B -0.5895
377 G B -0.3158
378 A B -0.0638
379 L B 0.2348
380 T B 0.0021
381 S B -0.0749
382 G B -0.1751
383 V B 0.3539
384 H B -0.1781
385 T B 0.0390
386 F B 0.0000
387 P B -0.2591
388 A B 0.3773
389 V B 0.5848
390 L B 0.8559
391 Q B -0.6080
392 S B -0.4494
393 S B -0.4357
394 G B 0.0000
395 L B -0.1900
396 Y B 0.0690
397 S B 0.0000
398 L B 0.0688
399 S B 0.0000
400 S B 0.0000
401 V B 0.0000
402 V B 0.0000
403 T B -0.0434
404 V B 0.0000
405 P B -0.5522
406 S B -0.5715
407 S B -0.6511
408 S B -0.7462
409 L B -0.8561
410 G B -1.1581
411 T B -0.9122
412 Q B -1.3721
413 T B -1.3690
414 Y B 0.0000
415 I B -1.5186
416 C B 0.0000
417 N B -1.6217
418 V B 0.0000
419 N B -1.9711
420 H B 0.0000
421 K B -2.6056
422 P B -1.6609
423 S B -1.8572
424 N B -2.4885
425 T B -2.1453
426 K B -2.6394
427 V B -1.8833
428 D B -2.7244
429 K B -2.3284
430 R B -2.9250
431 V B 0.0000
432 E B -2.6827
433 P B -1.7034
434 K B -1.6221
435 S B -1.2290
436 C B -1.3559
437 D B -2.1572
438 K B 0.0000
439 T B 0.0000
440 H B -1.8748
441 T B -1.2468
442 C B 0.0000
443 P B -0.9273
444 P B -0.4952
445 C B -0.3069
446 P B -0.7669
447 A B -0.9828
448 P B -1.0118
449 E B -1.4217
450 L B 0.3092
451 L B 0.9606
452 G B 0.0491
453 G B -0.1372
454 P B 0.0000
455 S B -0.0374
456 V B 0.0000
457 F B 0.9943
458 L B 0.0000
459 F B 1.2657
460 P B 0.0019
461 P B 0.0000
462 K B -1.9502
463 P B -1.2007
464 K B -1.0948
465 D B 0.0000
466 T B 0.0000
467 L B 0.0000
468 M B 0.5078
469 I B 1.5467
470 S B -0.0384
471 R B -1.2956
472 T B -0.6741
473 P B 0.0000
474 E B -1.0124
475 V B 0.0000
476 T B 0.6319
477 C B 0.0000
478 V B 0.0000
479 V B 0.0000
480 V B -0.3961
481 D B -0.9079
482 V B 0.0000
483 S B -1.8528
484 H B -2.3056
485 E B -2.8401
486 D B -2.4038
487 P B -2.4805
488 E B -2.8623
489 V B 0.0000
490 K B -2.4345
491 F B 0.0000
492 N B -1.6219
493 W B 0.0000
494 Y B -1.1880
495 V B -0.9001
496 D B -2.1144
497 G B -0.7956
498 V B 0.7096
499 E B -0.6685
500 V B 0.4207
501 H B -1.1183
502 N B -1.0948
503 A B -0.9828
504 K B -2.0348
505 T B 0.0000
506 K B -2.1505
507 P B -1.8955
508 R B -3.2708
509 E B -3.7917
510 E B -2.9870
511 Q B -2.4273
512 Y B -1.0700
513 N B -1.3314
514 S B -1.1473
515 T B -1.4022
516 Y B -2.1824
517 R B -2.0289
518 V B 0.0000
519 V B -0.7771
520 S B 0.0000
521 V B 0.0709
522 L B 0.0000
523 T B -0.3272
524 V B 0.4136
525 L B 1.0001
526 H B -0.0472
527 Q B -1.2311
528 D B -1.0167
529 W B 0.0000
530 L B -0.9007
531 N B -1.9768
532 G B -2.0635
533 K B -2.1018
534 E B -2.1794
535 Y B 0.0000
536 K B -1.8892
537 C B 0.0000
538 K B -1.9596
539 V B 0.0000
540 S B -1.4812
541 N B -1.8079
542 K B -2.0798
543 A B -1.2371
544 L B -0.5914
545 P B -0.4411
546 A B -0.3816
547 P B -0.5807
548 I B -0.5359
549 E B -1.5234
550 K B -1.3385
551 T B -1.1340
552 I B -0.1073
553 S B -1.4684
554 K B -1.3418
555 A B -1.2518
556 K B -2.3270
557 G B -2.0996
558 Q B -2.3458
559 P B -2.2221
560 R B -2.8210
561 E B -2.8103
562 P B 0.0000
563 Q B -1.3323
564 V B 0.0000
565 Y B 0.0000
566 T B 0.0000
567 L B 0.0000
568 P B -0.3939
569 P B 0.0000
570 S B -1.3555
571 R B -2.5555
572 E B -2.7378
573 E B 0.0000
574 M B -1.2827
575 T B -1.5439
576 K B -2.6550
577 N B -2.7166
578 Q B -2.5128
579 V B 0.0000
580 S B -0.2952
581 L B 0.0000
582 T B 0.0000
583 C B 0.0000
584 L B 0.0000
585 V B 0.0000
586 K B -0.6134
587 G B -1.1045
588 F B 0.0000
589 Y B -1.2480
590 P B 0.0000
591 S B 0.1432
592 D B -0.6759
593 I B -0.4866
594 A B -0.4780
595 V B 0.0000
596 E B -1.1272
597 W B 0.0000
598 E B -1.7100
599 S B 0.0000
600 N B -2.0326
601 G B -1.8074
602 Q B -2.0984
603 P B -1.8056
604 E B -1.8597
605 N B -1.8828
606 N B -1.5492
607 Y B -0.8980
608 K B -0.5222
609 T B -0.3379
610 T B 0.0000
611 P B 0.0594
612 P B 0.3514
613 V B 0.8838
614 L B 1.0729
615 D B -0.2498
616 S B -1.1531
617 D B -1.8927
618 G B -0.7536
619 S B -0.5045
620 F B 0.2074
621 F B 0.0000
622 L B 0.0000
623 Y B 0.0000
624 S B 0.0000
625 K B 0.0000
626 L B 0.0000
627 T B -0.8127
628 V B -1.3696
629 D B -2.6996
630 K B -2.6085
631 S B -2.3417
632 R B -2.8027
633 W B 0.0000
634 Q B -2.6725
635 Q B -2.6384
636 G B -1.8169
637 N B -1.5363
638 V B -0.7291
639 F B 0.0000
640 S B -1.0259
641 C B 0.0000
642 S B 0.0000
643 V B 0.0000
644 M B 0.0000
645 H B 0.0000
646 E B -1.0961
647 A B -1.8311
648 L B 0.0000
649 H B -1.8246
650 N B -1.7662
651 H B -1.2588
652 Y B -0.6888
653 T B -1.0507
654 Q B -1.2112
655 K B -1.1554
656 S B -0.5695
657 L B -0.1373
658 S B -0.6462
659 L B 0.0000
660 S B -0.9962
661 P B -0.8142
662 G B -1.2660
663 D C -0.4454
664 I C 1.5837
665 Q C 0.0000
666 M C 0.9359
667 T C 0.0000
668 Q C -0.8316
669 S C -0.6706
670 P C -0.7906
671 S C -0.7455
672 S C -0.6617
673 L C -0.2709
674 S C -0.6271
675 A C 0.0000
676 S C -0.8831
677 V C 0.2060
678 G C -0.6533
679 D C -1.4912
680 R C -2.3408
681 V C 0.0000
682 T C -0.6664
683 I C 0.0000
684 T C -0.5023
685 C C 0.0000
686 S C 0.2566
687 P C 0.0000
688 V C 1.6229
689 Q C -0.1383
690 Y C 0.1080
691 L C 0.0000
692 R C -1.2124
693 W C 0.4158
694 I C 0.4894
695 W C 0.0000
696 Y C 0.0000
697 W C 0.0000
698 Y C 0.0000
699 Q C 0.0000
700 Q C -1.1343
701 K C -1.5018
702 P C -1.3963
703 G C -1.7674
704 K C -2.4666
705 A C -1.5339
706 P C 0.0000
707 K C -1.0032
708 L C 0.0000
709 L C 0.0000
710 I C 0.0000
711 Y C 0.7872
712 A C 0.5535
713 A C 0.2732
714 S C 0.2348
715 S C 0.1502
716 L C 0.2429
717 Q C -0.1652
718 S C -0.3707
719 G C -0.4613
720 V C -0.2978
721 P C -0.8164
722 S C -0.9323
723 R C -1.8660
724 F C 0.0000
725 S C -0.5216
726 G C -0.0952
727 S C -0.3044
728 G C -0.5691
729 S C -0.4583
730 G C 0.0000
731 T C -0.3254
732 D C -0.8610
733 F C 0.0000
734 T C -0.5146
735 L C 0.0000
736 T C -0.7700
737 I C 0.0000
738 S C -1.6285
739 S C -1.2928
740 L C 0.0000
741 Q C -1.0583
742 P C -1.5000
743 E C -1.9316
744 D C 0.0000
745 F C 0.0000
746 A C 0.0000
747 T C -0.6201
748 Y C 0.0000
749 Y C 0.0000
750 C C 0.0000
751 Q C 0.0000
752 Q C 0.0000
753 L C 0.0659
754 N C -0.7057
755 S C -0.3216
756 Y C 0.6475
757 P C 0.0916
758 P C 0.0000
759 T C -0.0574
760 F C 0.0000
761 G C 0.0000
762 G C -0.7986
763 G C -0.8724
764 T C 0.0000
765 K C -1.0298
766 V C 0.0000
767 E C -1.2867
768 I C -1.1839
769 K C -1.5957
770 R C -1.9167
771 T C -0.4194
772 V C 0.8345
773 A C 0.2990
774 A C 0.1382
775 P C -0.1354
776 S C -0.2090
777 V C 0.0317
778 F C 0.2187
779 I C 0.0000
780 F C 0.0000
781 P C 0.0000
782 P C 0.0000
783 S C 0.0000
784 D C -2.7188
785 E C -2.4553
786 Q C 0.0000
787 L C -2.0527
788 K C -2.6010
789 S C -1.6153
790 G C -1.1494
791 T C -0.8029
792 A C 0.0000
793 S C 0.0000
794 V C 0.0000
795 V C 0.0000
796 C C 0.0000
797 L C 0.0000
798 L C 0.0000
799 N C 0.0000
800 N C -0.8023
801 F C 0.0000
802 Y C 0.0000
803 P C -1.8624
804 R C -3.1942
805 E C -3.3147
806 A C -2.5670
807 K C -2.6165
808 V C 0.0000
809 Q C -1.1919
810 W C 0.0000
811 K C -0.6038
812 V C -0.7783
813 D C -1.5455
814 N C -1.2836
815 A C -0.3364
816 L C 0.3724
817 Q C -1.0705
818 S C -0.9066
819 G C -1.3382
820 N C -2.0567
821 S C -1.7117
822 Q C -1.4750
823 E C -1.9398
824 S C 0.0000
825 V C -0.7526
826 T C -1.0894
827 E C -2.3331
828 Q C 0.0000
829 D C -2.2791
830 S C -2.2260
831 K C -2.3940
832 D C -2.1126
833 S C -2.2955
834 T C 0.0000
835 Y C 0.0000
836 S C 0.0000
837 L C -0.6963
838 S C 0.0000
839 S C 0.0000
840 T C -0.7702
841 L C 0.0000
842 T C -0.6021
843 L C -0.6062
844 S C -1.1507
845 K C -2.0255
846 A C -1.9113
847 D C -2.1042
848 Y C 0.0000
849 E C -3.6804
850 K C -3.4515
851 H C -3.0716
852 K C -3.4111
853 V C -1.6988
854 Y C 0.0000
855 A C -0.9088
856 C C 0.0000
857 E C -1.1627
858 V C 0.0000
859 T C -1.2658
860 H C 0.0000
861 Q C -1.7517
862 G C -0.3531
863 L C -0.0068
864 S C -0.3804
865 S C -0.3429
866 P C -0.5854
867 V C -0.0464
868 T C -0.4803
869 K C -0.6068
870 S C -0.7227
871 F C 0.0000
872 N C -2.4414
873 R C -2.7142
874 G C -1.9597
875 E C -1.6625
876 C C -0.4260
877 Q D -1.2823
878 V D -0.5553
879 Q D -0.5687
880 L D 0.0000
881 V D 0.2417
882 E D -0.2677
883 S D -0.5546
884 G D -0.7988
885 G D -0.4552
886 G D -0.0179
887 A D -0.2401
888 V D -1.0540
889 Q D -2.1200
890 P D -2.2756
891 G D -2.3258
892 R D -2.8278
893 S D -2.1903
894 L D -1.5871
895 R D -2.0925
896 L D 0.0000
897 S D -0.6718
898 C D 0.0000
899 A D -0.2755
900 A D 0.0000
901 S D -0.7078
902 G D -0.6394
903 F D 0.0463
904 T D -0.0740
905 F D 0.0000
906 S D -0.6380
907 S D 0.0983
908 Y D 0.8291
909 G D 0.0000
910 M D 0.0000
911 H D 0.0000
912 W D 0.0000
913 V D 0.0000
914 R D 0.0000
915 Q D -0.8864
916 A D -1.1700
917 P D -1.1059
918 G D -1.4768
919 K D -2.3494
920 G D -1.5499
921 L D -1.0705
922 E D -1.4390
923 W D 0.0000
924 V D 0.0000
925 A D 0.0000
926 V D 0.0000
927 I D 0.0000
928 L D -0.2654
929 Y D 0.1551
930 D D -1.6268
931 G D -1.5949
932 S D -1.5743
933 D D -2.2562
934 K D -1.5543
935 F D 0.1441
936 Y D -0.5584
937 A D -1.1414
938 D D -2.7075
939 S D -2.2942
940 V D 0.0000
941 K D -3.0295
942 G D -2.5820
943 R D -3.4039
944 F D 0.0000
945 T D -1.4326
946 I D 0.0000
947 S D -0.7052
948 R D -1.0751
949 D D -1.7991
950 N D -1.9557
951 S D -1.7624
952 K D -2.5362
953 N D -1.9210
954 T D -1.1602
955 L D 0.0000
956 Y D -0.5498
957 L D 0.0000
958 Q D -1.6101
959 M D 0.0000
960 N D -2.5596
961 S D -2.2947
962 L D 0.0000
963 R D -3.3357
964 A D -2.0899
965 E D -2.5446
966 D D -1.7013
967 T D -0.7070
968 A D 0.0000
969 V D 0.6301
970 Y D 0.0000
971 Y D 0.0000
972 C D 0.0000
973 A D 0.0000
974 K D 0.0000
975 V D 1.1083
976 A D 0.6349
977 V D 0.6757
978 A D 0.0000
979 G D 0.0000
980 T D 0.0000
981 H D -0.5670
982 F D 0.0399
983 D D 0.2107
984 Y D 0.5244
985 W D 0.0000
986 G D 0.0000
987 Q D -1.3076
988 G D -0.4798
989 T D 0.3414
990 L D 1.1855
991 V D 0.0000
992 T D -0.2004
993 V D 0.0000
994 S D -1.0499
995 S D -0.7421
996 A D -0.5754
997 S D -0.7197
998 T D -0.8599
999 K D -1.3376
1000 G D -1.5789
1001 P D -0.9223
1002 S D -0.6077
1003 V D 0.0000
1004 F D -0.6691
1005 P D -1.2923
1006 L D 0.0000
1007 A D 0.0000
1008 P D -0.7218
1009 S D -1.1099
1010 S D -1.2321
1011 K D -2.0309
1012 S D -1.2621
1013 T D -0.9756
1014 S D -0.8746
1015 G D -0.7647
1016 G D -0.6851
1017 T D -0.5226
1018 A D 0.0000
1019 A D 0.0342
1020 L D 0.0000
1021 G D 0.0000
1022 C D 0.0000
1023 L D 0.0000
1024 V D 0.0000
1025 K D -0.5671
1026 D D -1.1488
1027 Y D 0.0000
1028 F D 0.0000
1029 P D 0.0000
1030 E D -0.6636
1031 P D -0.7623
1032 V D -0.9252
1033 T D -0.6497
1034 V D -0.1862
1035 S D -0.3268
1036 W D 0.0000
1037 N D -0.8667
1038 S D -0.6645
1039 G D -0.4093
1040 A D -0.1758
1041 L D 0.0792
1042 T D -0.0513
1043 S D -0.0652
1044 G D 0.0198
1045 V D 0.4604
1046 H D -0.0567
1047 T D 0.1182
1048 F D 0.0000
1049 P D -0.1584
1050 A D 0.2859
1051 V D 0.7974
1052 L D 1.2319
1053 Q D -0.2986
1054 S D -0.2644
1055 S D -0.3641
1056 G D 0.0000
1057 L D -0.0829
1058 Y D 0.1184
1059 S D 0.0029
1060 L D 0.0372
1061 S D 0.0000
1062 S D 0.0000
1063 V D 0.0000
1064 V D 0.0000
1065 T D -0.0277
1066 V D 0.0000
1067 P D -0.5449
1068 S D -0.6264
1069 S D -0.7043
1070 S D -0.8526
1071 L D 0.0000
1072 G D -1.2445
1073 T D -0.9777
1074 Q D -1.4417
1075 T D -1.4278
1076 Y D 0.0000
1077 I D -1.3854
1078 C D 0.0000
1079 N D -1.6550
1080 V D 0.0000
1081 N D -2.2376
1082 H D 0.0000
1083 K D -2.8276
1084 P D -1.7728
1085 S D -1.9052
1086 N D -2.6005
1087 T D -2.2449
1088 K D -2.7463
1089 V D -1.9158
1090 D D -2.7454
1091 K D -2.3086
1092 R D -2.9212
1093 V D 0.0000
1094 E D -2.6823
1095 P D -1.6535
1096 K D -1.4336
1097 S D -1.4368
1098 C D -0.9272
1099 D D -1.9920
1100 K D -2.4036
1101 T D -1.8625
1102 H D 0.0000
1103 T D -1.1396
1104 C D -1.1259
1105 P D -0.7949
1106 P D -0.6597
1107 C D -0.6615
1108 P D -0.5848
1109 A D -0.9767
1110 P D -0.8342
1111 E D -1.2694
1112 L D 0.2194
1113 L D 1.3119
1114 G D 0.0727
1115 G D -0.2083
1116 P D -0.0976
1117 S D 0.0048
1118 V D 0.0000
1119 F D 1.1715
1120 L D 0.0000
1121 F D 1.5038
1122 P D 0.1387
1123 P D 0.0000
1124 K D -2.0578
1125 P D -1.3424
1126 K D -1.1613
1127 D D -1.3669
1128 T D 0.0000
1129 L D 0.0000
1130 M D 0.5497
1131 I D 1.4972
1132 S D -0.0382
1133 R D -1.3110
1134 T D -0.7689
1135 P D 0.0000
1136 E D -1.2594
1137 V D 0.0000
1138 T D 0.6405
1139 C D 0.0000
1140 V D 0.0000
1141 V D 0.0000
1142 V D 0.1455
1143 D D -0.0919
1144 V D 0.0000
1145 S D -1.4998
1146 H D -2.2924
1147 E D -2.7547
1148 D D -2.1129
1149 P D -2.0784
1150 E D -2.3066
1151 V D 0.0000
1152 K D -2.3357
1153 F D 0.0000
1154 N D -1.8891
1155 W D 0.0000
1156 Y D -1.4337
1157 V D -1.0344
1158 D D -2.1477
1159 G D -0.9161
1160 V D 0.4701
1161 E D -1.1361
1162 V D -0.2353
1163 H D -1.4473
1164 N D -1.3093
1165 A D -1.0460
1166 K D -2.0037
1167 T D 0.0000
1168 K D -1.7809
1169 P D -2.1132
1170 R D -2.9388
1171 E D -3.0212
1172 E D -3.1319
1173 Q D -1.8715
1174 Y D -0.1239
1175 N D -0.3279
1176 S D -0.3583
1177 T D 0.0000
1178 Y D -1.6167
1179 R D -2.0199
1180 V D 0.0000
1181 V D -0.7516
1182 S D 0.0000
1183 V D 0.0060
1184 L D 0.0000
1185 T D -0.4643
1186 V D 0.3095
1187 L D 0.8729
1188 H D 0.0000
1189 Q D -0.9945
1190 D D -0.9327
1191 W D 0.0000
1192 L D -0.8848
1193 N D -1.9572
1194 G D -2.0975
1195 K D -2.1253
1196 E D -2.1935
1197 Y D 0.0000
1198 K D -1.9040
1199 C D 0.0000
1200 K D -1.9603
1201 V D 0.0000
1202 S D -1.4531
1203 N D -1.7306
1204 K D -2.1911
1205 A D -1.2770
1206 L D -0.6289
1207 P D -0.4887
1208 A D -0.3436
1209 P D -0.5342
1210 I D -0.4290
1211 E D -1.6412
1212 K D -1.2262
1213 T D -1.0598
1214 I D 0.0180
1215 S D -1.5150
1216 K D -1.5377
1217 A D -1.3897
1218 K D -2.3992
1219 G D -2.1059
1220 Q D -2.1396
1221 P D -2.1307
1222 R D -2.5494
1223 E D -2.4704
1224 P D 0.0000
1225 Q D -1.2285
1226 V D 0.0000
1227 Y D -0.8043
1228 T D -0.5474
1229 L D -0.2302
1230 P D -0.1918
1231 P D 0.0000
1232 S D -1.2511
1233 R D -2.3948
1234 E D -2.2630
1235 E D 0.0000
1236 M D -1.4931
1237 T D -1.5563
1238 K D -2.5109
1239 N D -2.6927
1240 Q D -2.6253
1241 V D 0.0000
1242 S D 0.0000
1243 L D 0.0000
1244 T D 0.0000
1245 C D 0.0000
1246 L D 0.0000
1247 V D 0.0000
1248 K D -0.5253
1249 G D -0.9922
1250 F D 0.0000
1251 Y D -1.2158
1252 P D 0.0000
1253 S D -0.1531
1254 D D -0.9578
1255 I D 0.0000
1256 A D -0.5620
1257 V D 0.0000
1258 E D -1.3694
1259 W D 0.0000
1260 E D -2.2323
1261 S D -2.1534
1262 N D -2.3985
1263 G D -1.9655
1264 Q D -2.3566
1265 P D -2.2752
1266 E D -2.7315
1267 N D -2.2731
1268 N D -1.6000
1269 Y D -1.0306
1270 K D -0.4952
1271 T D -0.3211
1272 T D 0.0000
1273 P D 0.0460
1274 P D 0.3163
1275 V D 0.9158
1276 L D 1.1487
1277 D D -0.2739
1278 S D -1.2413
1279 D D -1.9562
1280 G D -0.8380
1281 S D 0.0000
1282 F D 0.2515
1283 F D 0.0000
1284 L D 0.0000
1285 Y D 0.0000
1286 S D 0.0000
1287 K D 0.0000
1288 L D 0.0000
1289 T D -0.9089
1290 V D 0.0000
1291 D D -2.7216
1292 K D -2.7450
1293 S D -2.5999
1294 R D -3.4096
1295 W D -2.4392
1296 Q D -2.7556
1297 Q D -2.8841
1298 G D -1.9352
1299 N D -1.9869
1300 V D -1.0827
1301 F D 0.0000
1302 S D -1.1521
1303 C D 0.0000
1304 S D -0.8356
1305 V D 0.0000
1306 M D 0.0000
1307 H D 0.0000
1308 E D -1.0393
1309 A D -1.7178
1310 L D 0.0000
1311 H D -1.6731
1312 N D -1.6066
1313 H D -0.7423
1314 Y D -0.2656
1315 T D -0.8992
1316 Q D -1.3049
1317 K D -1.0170
1318 S D -0.5744
1319 L D -0.0505
1320 S D -0.6072
1321 L D 0.0000
1322 S D -0.9169
1323 P D -0.7310
1324 G D -1.1110

 

Laboratory of Theory of Biopolymers 2015