Project name: 1L6W [mutate: KA97Y, KA100Y, EA102Y, KB97Y, KB100Y, EB102Y, KC97Y, KC100Y, EC102Y, KD97Y, KD100Y, ED102Y, KE97Y, KE100Y, EE102Y, KF97Y, KF100Y, EF102Y, KG97Y, KG100Y, EG102Y, KH97Y, KH100Y, EH102Y, KI97Y, KI100Y, EI102Y, KJ97Y, KJ100Y, EJ102Y]

Status: done

submitted: 2017-09-12 19:54:17, status changed: 2017-09-12 21:15:02
Settings
Chain sequence(s) A: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
C: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
B: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
E: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
D: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
G: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
F: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
I: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
H: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
J: MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues KA97Y, KA100Y, EA102Y, KB97Y, KB100Y, EB102Y, KC97Y, KC100Y, EC102Y, KD97Y, KD100Y, ED102Y, KE97Y, KE100Y, EE102Y, KF97Y, KF100Y, EF102Y, KG97Y, KG100Y, EG102Y, KH97Y, KH100Y, EH102Y, KI97Y, KI100Y, EI102Y, KJ97Y, KJ100Y, EJ102Y
Energy difference between WT (input) and mutated protein (by FoldX) -3.29277 kcal/mol
Show buried residues

Minimal score value
-3.2469
Maximal score value
2.0263
Average score
-0.4728
Total score value
-1040.1851

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.0866
2 E A -0.2861
3 L A 0.0000
4 Y A 0.0000
5 L A 0.0000
6 D A -0.3594
7 T A 0.0000
8 S A -0.7451
9 D A -0.9271
10 V A -0.3316
11 V A 0.9408
12 A A 0.1259
13 V A 0.0000
14 K A -1.7360
15 A A -0.4360
16 L A -0.3469
17 S A -0.9240
18 R A -1.0494
19 I A -0.3426
20 F A 0.0000
21 P A 0.0607
22 L A -0.2074
23 A A -0.4608
24 G A 0.0000
25 V A 0.0000
26 T A 0.0000
27 T A 0.0000
28 N A -0.1223
29 P A 0.0000
30 S A -0.8055
31 I A -0.3072
32 I A 0.0000
33 A A 0.0000
34 A A -0.8941
35 G A -1.4526
36 K A -2.1477
37 K A -1.8578
38 P A -1.1581
39 L A 0.0000
40 D A -1.6425
41 V A -0.3759
42 V A 0.0000
43 L A 0.0000
44 P A -0.9854
45 Q A -1.3405
46 L A 0.0000
47 H A -2.1912
48 E A -2.9290
49 A A 0.0000
50 M A 0.0000
51 G A -2.1213
52 G A -2.2916
53 Q A -2.2738
54 G A -1.8627
55 R A -1.6257
56 L A 0.0000
57 F A 0.0000
58 A A 0.0000
59 Q A 0.0000
60 V A 0.0000
61 M A 0.0000
62 A A -0.6319
63 T A -0.5139
64 T A -1.0382
65 A A 0.0000
66 E A -2.2610
67 G A -1.4264
68 M A 0.0000
69 V A 0.0000
70 N A -1.4979
71 D A 0.0000
72 A A 0.0000
73 L A 0.3197
74 K A -0.6608
75 L A 0.0000
76 R A -0.6535
77 S A -0.5836
78 I A -0.5248
79 I A 0.0000
80 A A -0.8428
81 D A -1.9883
82 I A 0.0000
83 V A 0.0000
84 V A 0.0000
85 K A 0.0000
86 V A 0.0000
87 P A 0.0000
88 V A 0.0000
89 T A -0.5175
90 A A -0.6553
91 E A -1.1686
92 G A 0.0000
93 L A 0.0000
94 A A 0.0000
95 A A 0.0000
96 I A 0.0000
97 Y A 1.2464 mutated: KA97Y
98 M A 0.9862
99 L A 0.0000
100 Y A 1.8351 mutated: KA100Y
101 A A 1.5132
102 Y A 1.7882 mutated: EA102Y
103 G A 0.8511
104 I A 0.4791
105 P A -0.2386
106 T A 0.0000
107 L A 0.0000
108 G A 0.0000
109 T A 0.0000
110 A A 0.0000
111 V A 0.0000
112 Y A 0.0000
113 G A 0.0000
114 A A 0.0000
115 A A 0.0000
116 Q A 0.0000
117 G A 0.0000
118 L A 0.0000
119 L A 0.0000
120 S A 0.0000
121 A A 0.0000
122 L A 0.2071
123 A A 0.0000
124 G A 0.1322
125 A A 0.0000
126 E A -1.6774
127 Y A 0.0000
128 V A 0.0000
129 A A 0.0000
130 P A 0.0000
131 Y A 0.0000
132 V A 0.0000
133 N A -0.7051
134 R A -0.8815
135 I A 0.0000
136 D A 0.0000
137 A A 0.0000
138 Q A -0.6557
139 G A -0.5383
140 G A -0.7783
141 S A -0.6253
142 G A 0.0000
143 I A -0.2419
144 Q A -1.0696
145 T A 0.0000
146 V A 0.0000
147 T A -0.6097
148 D A 0.0000
149 L A 0.0000
150 H A -1.2269
151 Q A -1.3669
152 L A 0.0000
153 L A 0.0000
154 K A -2.1967
155 M A -0.7851
156 H A 0.0000
157 A A 0.0000
158 P A -1.5829
159 Q A -2.0194
160 A A 0.0000
161 K A -1.7109
162 V A 0.0000
163 L A 0.0000
164 A A 0.0000
165 A A -0.2281
166 S A -0.4191
167 F A 0.0000
168 K A -1.3635
169 T A 0.0000
170 P A 0.0000
171 R A -0.6754
172 Q A 0.0000
173 A A 0.0000
174 L A 0.0000
175 D A -0.3533
176 C A 0.0000
177 L A 0.0000
178 L A 0.0325
179 A A -0.2880
180 G A -0.4606
181 C A 0.0000
182 E A -0.4545
183 S A 0.0000
184 I A 0.0000
185 T A 0.0000
186 L A 0.0000
187 P A -0.7280
188 L A -1.0124
189 D A -2.1383
190 V A 0.0000
191 A A 0.0000
192 Q A -1.6038
193 Q A -1.3497
194 M A 0.0000
195 I A 0.0000
196 S A -0.8718
197 Y A 0.0000
198 P A -0.9674
199 A A -0.9013
200 V A 0.0000
201 D A -1.9329
202 A A -1.1913
203 A A 0.0000
204 V A -1.1839
205 A A -1.5900
206 K A -2.2685
207 F A 0.0000
208 E A -2.1645
209 Q A -2.7351
210 D A -1.8861
211 W A 0.0000
212 Q A -2.6004
213 G A -1.9471
214 A A -1.6379
215 F A -1.2125
216 G A -1.6275
217 R A -1.8415
218 T A -1.2698
219 S A -0.8293
220 I A -0.3827
1 M B 0.0688
2 E B -0.3145
3 L B 0.0000
4 Y B 0.0000
5 L B 0.0000
6 D B -0.3350
7 T B 0.0000
8 S B -0.7583
9 D B -0.9218
10 V B -0.3054
11 V B 0.9419
12 A B 0.1202
13 V B 0.0000
14 K B -1.9171
15 A B -0.7227
16 L B -0.6327
17 S B -1.3365
18 R B -1.9568
19 I B -0.8096
20 F B 0.0000
21 P B -0.0112
22 L B -0.2388
23 A B -0.4467
24 G B 0.0000
25 V B 0.0000
26 T B 0.0000
27 T B 0.0000
28 N B -0.0669
29 P B 0.0000
30 S B -1.2217
31 I B -0.4073
32 I B 0.0000
33 A B 0.0000
34 A B -1.0852
35 G B -1.5247
36 K B -2.2144
37 K B -1.9304
38 P B -1.1365
39 L B 0.0000
40 D B -1.5999
41 V B -0.3154
42 V B 0.0000
43 L B 0.0000
44 P B -0.9757
45 Q B -1.3098
46 L B 0.0000
47 H B -2.1452
48 E B -2.8763
49 A B 0.0000
50 M B -2.1798
51 G B -2.0829
52 G B -2.2279
53 Q B -2.2832
54 G B -1.9509
55 R B -1.7060
56 L B 0.0000
57 F B 0.0000
58 A B 0.0000
59 Q B 0.0000
60 V B 0.0000
61 M B -0.2157
62 A B -0.6967
63 T B -0.3932
64 T B -0.9496
65 A B 0.0000
66 E B -2.2662
67 G B -1.4413
68 M B 0.0000
69 V B 0.0000
70 N B -1.5656
71 D B -0.8819
72 A B 0.0000
73 L B 0.3032
74 K B -0.6287
75 L B 0.0000
76 R B -0.6469
77 S B -0.5849
78 I B -0.5436
79 I B 0.0000
80 A B -0.8365
81 D B -2.0144
82 I B 0.0000
83 V B 0.0000
84 V B 0.0000
85 K B 0.0000
86 V B 0.0000
87 P B 0.0000
88 V B 0.0000
89 T B -0.4101
90 A B -0.3862
91 E B -0.7852
92 G B 0.0000
93 L B 0.0000
94 A B 0.0000
95 A B 0.0000
96 I B 0.0000
97 Y B 1.9007 mutated: KB97Y
98 M B 1.2149
99 L B 0.0000
100 Y B 2.0263 mutated: KB100Y
101 A B 1.6131
102 Y B 1.8495 mutated: EB102Y
103 G B 0.9129
104 I B 0.5203
105 P B -0.1317
106 T B 0.0000
107 L B 0.0000
108 G B 0.0000
109 T B 0.0000
110 A B 0.0000
111 V B 0.0000
112 Y B 0.0000
113 G B 0.0000
114 A B 0.0000
115 A B -0.0939
116 Q B 0.0000
117 G B 0.0000
118 L B 0.0000
119 L B 0.0000
120 S B 0.0000
121 A B 0.0000
122 L B 0.3329
123 A B 0.0000
124 G B 0.3530
125 A B 0.0000
126 E B -1.3027
127 Y B 0.0000
128 V B 0.0000
129 A B 0.0000
130 P B 0.0000
131 Y B 0.0000
132 V B 0.0000
133 N B 0.0000
134 R B -1.2981
135 I B 0.0000
136 D B 0.0000
137 A B 0.0000
138 Q B -0.8499
139 G B -0.6452
140 G B -0.8482
141 S B -0.6996
142 G B 0.0000
143 I B -0.3220
144 Q B -1.1419
145 T B 0.0000
146 V B 0.0000
147 T B -0.6570
148 D B 0.0000
149 L B 0.0000
150 H B -1.3454
151 Q B -1.4297
152 L B 0.0000
153 L B 0.0000
154 K B -2.2788
155 M B -0.9042
156 H B -0.6764
157 A B 0.0000
158 P B -1.6376
159 Q B -1.9680
160 A B 0.0000
161 K B -1.6953
162 V B 0.0000
163 L B 0.0000
164 A B 0.0000
165 A B -0.1753
166 S B -0.4645
167 F B 0.0000
168 K B -1.3972
169 T B 0.0000
170 P B 0.0000
171 R B -0.6949
172 Q B 0.0000
173 A B 0.0000
174 L B 0.0000
175 D B -0.4591
176 C B 0.0000
177 L B 0.0000
178 L B -0.0188
179 A B -0.3354
180 G B 0.0000
181 C B 0.0000
182 E B -0.6060
183 S B 0.0000
184 I B 0.0000
185 T B 0.0000
186 L B 0.0000
187 P B -0.6970
188 L B -1.0300
189 D B -2.1981
190 V B 0.0000
191 A B 0.0000
192 Q B -1.6599
193 Q B -1.7137
194 M B 0.0000
195 I B 0.0000
196 S B -0.9687
197 Y B 0.0000
198 P B -0.9806
199 A B -0.8776
200 V B 0.0000
201 D B -1.8652
202 A B -1.0914
203 A B 0.0000
204 V B -0.9271
205 A B -1.3261
206 K B -1.9927
207 F B 0.0000
208 E B -1.9429
209 Q B -2.6097
210 D B -1.9705
211 W B 0.0000
212 Q B -2.7014
213 G B -1.9647
214 A B -1.6426
215 F B -1.5438
216 G B -1.9344
217 R B -2.6967
218 T B -1.7664
219 S B -0.8201
220 I B -0.3175
1 M C 0.0940
2 E C -0.3368
3 L C 0.0000
4 Y C 0.0000
5 L C 0.0000
6 D C -0.3848
7 T C 0.0000
8 S C -0.7842
9 D C -0.9228
10 V C -0.2402
11 V C 1.0091
12 A C 0.1953
13 V C 0.0000
14 K C -1.5679
15 A C -0.3621
16 L C -0.2940
17 S C -0.9083
18 R C -1.0439
19 I C -0.2373
20 F C 0.0000
21 P C 0.1593
22 L C -0.2455
23 A C -0.5601
24 G C 0.0000
25 V C 0.0000
26 T C 0.0000
27 T C 0.0000
28 N C -0.1395
29 P C 0.0000
30 S C -0.8807
31 I C -0.3410
32 I C 0.0000
33 A C 0.0000
34 A C -0.9256
35 G C -1.5095
36 K C -2.2056
37 K C -1.9445
38 P C -1.1199
39 L C 0.0000
40 D C -1.7221
41 V C -0.3977
42 V C 0.0000
43 L C 0.0000
44 P C -0.9118
45 Q C -1.2844
46 L C 0.0000
47 H C -2.0945
48 E C -2.8243
49 A C 0.0000
50 M C 0.0000
51 G C -2.1188
52 G C -2.0785
53 Q C -2.2150
54 G C -2.0654
55 R C -1.7318
56 L C 0.0000
57 F C 0.0000
58 A C 0.0000
59 Q C 0.0000
60 V C 0.0000
61 M C 0.0000
62 A C -0.5829
63 T C -0.4361
64 T C -0.9332
65 A C 0.0000
66 E C -2.2526
67 G C -1.4463
68 M C 0.0000
69 V C 0.0000
70 N C -1.7518
71 D C -1.1252
72 A C 0.0000
73 L C -0.1151
74 K C -1.4480
75 L C 0.0000
76 R C -0.8626
77 S C -0.8400
78 I C -0.6452
79 I C -0.8237
80 A C -0.8230
81 D C -1.9589
82 I C 0.0000
83 V C 0.0000
84 V C 0.0000
85 K C 0.0000
86 V C 0.0000
87 P C 0.0000
88 V C 0.0000
89 T C -0.3985
90 A C -0.3858
91 E C -0.7086
92 G C 0.0000
93 L C 0.0000
94 A C 0.0000
95 A C 0.0000
96 I C 0.0000
97 Y C 1.3333 mutated: KC97Y
98 M C 0.9960
99 L C 0.0000
100 Y C 1.8344 mutated: KC100Y
101 A C 1.4801
102 Y C 1.7707 mutated: EC102Y
103 G C 0.8400
104 I C 0.5104
105 P C -0.1534
106 T C 0.0000
107 L C 0.0000
108 G C 0.0000
109 T C 0.0000
110 A C 0.0000
111 V C 0.0000
112 Y C 0.0000
113 G C 0.0000
114 A C 0.0000
115 A C 0.0000
116 Q C 0.0000
117 G C 0.0000
118 L C 0.0000
119 L C 0.0000
120 S C 0.0000
121 A C 0.0000
122 L C 0.2438
123 A C 0.0000
124 G C 0.1759
125 A C 0.0000
126 E C -1.3400
127 Y C 0.0000
128 V C 0.0000
129 A C 0.0000
130 P C 0.0000
131 Y C 0.0000
132 V C 0.0000
133 N C 0.0000
134 R C -0.8325
135 I C 0.0000
136 D C 0.0000
137 A C 0.0000
138 Q C -0.6356
139 G C -0.5406
140 G C -0.7824
141 S C -0.6348
142 G C 0.0000
143 I C -0.3120
144 Q C -1.1632
145 T C 0.0000
146 V C 0.0000
147 T C -0.6670
148 D C -0.8903
149 L C 0.0000
150 H C -1.2576
151 Q C -1.2650
152 L C 0.0000
153 L C 0.0000
154 K C -2.2115
155 M C -0.8872
156 H C 0.0000
157 A C 0.0000
158 P C -1.5929
159 Q C -1.9590
160 A C 0.0000
161 K C -1.6365
162 V C 0.0000
163 L C 0.0000
164 A C 0.0000
165 A C -0.1997
166 S C -0.3560
167 F C 0.0000
168 K C -1.2323
169 T C 0.0000
170 P C 0.0000
171 R C -0.6918
172 Q C 0.0000
173 A C 0.0000
174 L C 0.0000
175 D C -0.4265
176 C C 0.0000
177 L C 0.0000
178 L C 0.0667
179 A C -0.3378
180 G C -0.4793
181 C C 0.0000
182 E C -0.5984
183 S C 0.0000
184 I C 0.0000
185 T C 0.0000
186 L C 0.0000
187 P C -0.7073
188 L C -0.9994
189 D C -2.1017
190 V C 0.0000
191 A C 0.0000
192 Q C -1.5608
193 Q C -1.3260
194 M C 0.0000
195 I C 0.0000
196 S C -0.8235
197 Y C 0.0000
198 P C -0.9732
199 A C -0.7461
200 V C 0.0000
201 D C -1.9193
202 A C -1.2688
203 A C 0.0000
204 V C -1.0791
205 A C -1.8154
206 K C -2.8336
207 F C -1.9056
208 E C -2.8020
209 Q C -3.2469
210 D C -2.8741
211 W C 0.0000
212 Q C -2.9423
213 G C -2.2633
214 A C -1.8307
215 F C -1.6324
216 G C -1.9589
217 R C -2.6392
218 T C -1.8983
219 S C -0.9200
220 I C -0.4919
1 M D -0.0231
2 E D -0.3558
3 L D 0.0000
4 Y D 0.0000
5 L D 0.0000
6 D D -0.3344
7 T D 0.0000
8 S D -0.7299
9 D D -0.7761
10 V D -0.2231
11 V D 1.0685
12 A D 0.2407
13 V D 0.0000
14 K D -1.3933
15 A D -0.2857
16 L D -0.2568
17 S D -0.8158
18 R D -1.0119
19 I D -0.2882
20 F D 0.0000
21 P D 0.1355
22 L D -0.1801
23 A D -0.5236
24 G D 0.0000
25 V D 0.0000
26 T D 0.0000
27 T D 0.0000
28 N D -0.1240
29 P D 0.0000
30 S D -0.6763
31 I D -0.3003
32 I D 0.0000
33 A D 0.0000
34 A D -0.9183
35 G D -1.4925
36 K D -2.1919
37 K D -1.7819
38 P D -1.0535
39 L D 0.0000
40 D D -1.6584
41 V D -0.3384
42 V D 0.0000
43 L D 0.0000
44 P D -0.9240
45 Q D -1.3046
46 L D 0.0000
47 H D -2.1811
48 E D -2.8220
49 A D 0.0000
50 M D -2.0250
51 G D -2.0046
52 G D -2.1447
53 Q D -2.2882
54 G D -2.0818
55 R D -1.9425
56 L D 0.0000
57 F D 0.0000
58 A D 0.0000
59 Q D 0.0000
60 V D 0.0000
61 M D 0.0000
62 A D -0.4890
63 T D -0.4467
64 T D -0.9547
65 A D 0.0000
66 E D -2.2665
67 G D -1.3209
68 M D 0.0000
69 V D 0.0000
70 N D -1.6187
71 D D -0.8877
72 A D 0.0000
73 L D 0.1746
74 K D -1.0602
75 L D 0.0000
76 R D -0.7624
77 S D -0.7157
78 I D -0.5581
79 I D -0.7799
80 A D -0.7919
81 D D -2.0158
82 I D 0.0000
83 V D 0.0000
84 V D 0.0000
85 K D 0.0000
86 V D 0.0000
87 P D 0.0000
88 V D 0.0000
89 T D -0.3987
90 A D -0.3804
91 E D -0.6895
92 G D 0.0000
93 L D 0.0000
94 A D 0.0000
95 A D 0.0000
96 I D 0.0000
97 Y D 1.2963 mutated: KD97Y
98 M D 0.9612
99 L D 0.0000
100 Y D 1.7389 mutated: KD100Y
101 A D 1.4294
102 Y D 1.8381 mutated: ED102Y
103 G D 0.7392
104 I D 0.0000
105 P D -0.3236
106 T D 0.0000
107 L D 0.0000
108 G D 0.0000
109 T D 0.0000
110 A D 0.0000
111 V D 0.0000
112 Y D 0.0000
113 G D 0.0000
114 A D 0.0000
115 A D 0.0000
116 Q D 0.0000
117 G D 0.0000
118 L D 0.0000
119 L D 0.0000
120 S D 0.0000
121 A D 0.0000
122 L D 0.0894
123 A D 0.0000
124 G D 0.0525
125 A D 0.0000
126 E D -1.5873
127 Y D 0.0000
128 V D 0.0000
129 A D 0.0000
130 P D 0.0000
131 Y D 0.0000
132 V D 0.0000
133 N D 0.0000
134 R D -0.7509
135 I D 0.0000
136 D D 0.0000
137 A D 0.0000
138 Q D -0.6119
139 G D -0.5147
140 G D -0.7506
141 S D -0.6247
142 G D 0.0000
143 I D -0.3442
144 Q D -1.1865
145 T D 0.0000
146 V D 0.0000
147 T D -0.7068
148 D D -0.9259
149 L D 0.0000
150 H D -1.3351
151 Q D -1.3554
152 L D 0.0000
153 L D 0.0000
154 K D -2.2481
155 M D -0.9158
156 H D 0.0000
157 A D 0.0000
158 P D -1.5617
159 Q D -1.9720
160 A D 0.0000
161 K D -1.7231
162 V D 0.0000
163 L D 0.0000
164 A D 0.0000
165 A D 0.0000
166 S D -0.3221
167 F D 0.0000
168 K D -1.1380
169 T D 0.0000
170 P D 0.0000
171 R D -0.6784
172 Q D 0.0000
173 A D 0.0000
174 L D 0.0000
175 D D -0.4824
176 C D 0.0000
177 L D 0.0000
178 L D -0.0273
179 A D -0.3407
180 G D 0.0000
181 C D 0.0000
182 E D -0.6995
183 S D 0.0000
184 I D 0.0000
185 T D 0.0000
186 L D 0.0000
187 P D -0.6794
188 L D -1.0155
189 D D -2.1471
190 V D 0.0000
191 A D 0.0000
192 Q D -1.6234
193 Q D -1.5792
194 M D 0.0000
195 I D 0.0000
196 S D -0.9202
197 Y D 0.0000
198 P D -0.9824
199 A D -0.8718
200 V D 0.0000
201 D D -1.8731
202 A D -1.1357
203 A D 0.0000
204 V D -0.9808
205 A D -1.4348
206 K D -2.1805
207 F D 0.0000
208 E D -2.1924
209 Q D -2.7777
210 D D -2.0701
211 W D 0.0000
212 Q D -2.8598
213 G D -2.0139
214 A D -1.6851
215 F D -1.3929
216 G D -1.9567
217 R D -2.6435
218 T D -1.7435
219 S D -0.6432
220 I D 0.1236
1 M E 0.1004
2 E E -0.2389
3 L E 0.0000
4 Y E 0.0000
5 L E 0.0000
6 D E -0.3858
7 T E 0.0000
8 S E -0.4901
9 D E -0.7838
10 V E -0.2705
11 V E 0.9671
12 A E 0.1576
13 V E 0.0000
14 K E -1.7812
15 A E -0.4808
16 L E -0.3733
17 S E -0.9704
18 R E -1.1888
19 I E -0.3435
20 F E 0.0000
21 P E 0.1255
22 L E -0.0944
23 A E -0.3856
24 G E 0.0000
25 V E 0.0000
26 T E 0.0000
27 T E 0.0000
28 N E -0.1496
29 P E 0.0000
30 S E -0.6821
31 I E -0.2882
32 I E 0.0000
33 A E 0.0000
34 A E -0.7420
35 G E -1.4441
36 K E -2.1532
37 K E -1.7297
38 P E -1.1557
39 L E 0.0000
40 D E -1.5542
41 V E -0.3303
42 V E 0.0000
43 L E 0.0000
44 P E -1.0127
45 Q E -1.4514
46 L E 0.0000
47 H E -2.2928
48 E E -3.0285
49 A E 0.0000
50 M E 0.0000
51 G E -2.3133
52 G E -2.3142
53 Q E -2.3165
54 G E -1.9185
55 R E -1.4825
56 L E 0.0000
57 F E 0.0000
58 A E 0.0000
59 Q E 0.0000
60 V E 0.0000
61 M E 0.0000
62 A E -0.7836
63 T E -0.5257
64 T E -0.9549
65 A E 0.0000
66 E E -2.2334
67 G E -1.3767
68 M E 0.0000
69 V E 0.0000
70 N E -1.5487
71 D E 0.0000
72 A E 0.0000
73 L E 0.3168
74 K E -0.7338
75 L E 0.0000
76 R E -0.5856
77 S E -0.5411
78 I E -0.4176
79 I E -0.6618
80 A E -0.7226
81 D E -1.8926
82 I E 0.0000
83 V E 0.0000
84 V E 0.0000
85 K E 0.0000
86 V E 0.0000
87 P E 0.0000
88 V E 0.0000
89 T E -0.3944
90 A E -0.3762
91 E E -0.6795
92 G E 0.0000
93 L E 0.0000
94 A E 0.0000
95 A E 0.0000
96 I E 0.0000
97 Y E 1.1702 mutated: KE97Y
98 M E 0.8902
99 L E 0.0000
100 Y E 1.7755 mutated: KE100Y
101 A E 1.4267
102 Y E 1.7390 mutated: EE102Y
103 G E 0.8081
104 I E 0.5076
105 P E -0.1281
106 T E 0.0000
107 L E 0.0000
108 G E 0.0000
109 T E 0.0000
110 A E 0.0000
111 V E 0.0000
112 Y E 0.0000
113 G E 0.0000
114 A E 0.0000
115 A E 0.0000
116 Q E 0.0000
117 G E 0.0000
118 L E 0.0000
119 L E 0.0000
120 S E 0.0000
121 A E 0.0000
122 L E 0.2296
123 A E 0.0000
124 G E 0.1382
125 A E 0.0000
126 E E -1.1616
127 Y E 0.0000
128 V E 0.0000
129 A E 0.0000
130 P E 0.0000
131 Y E 0.0000
132 V E 0.0000
133 N E 0.0000
134 R E -0.9047
135 I E 0.0000
136 D E 0.0000
137 A E 0.0000
138 Q E -0.6505
139 G E -0.5513
140 G E -0.7893
141 S E -0.6515
142 G E 0.0000
143 I E -0.3235
144 Q E -1.1406
145 T E -0.6580
146 V E 0.0000
147 T E -0.6272
148 D E 0.0000
149 L E 0.0000
150 H E -1.2883
151 Q E -1.3504
152 L E 0.0000
153 L E 0.0000
154 K E -2.2473
155 M E -0.9088
156 H E 0.0000
157 A E 0.0000
158 P E -1.6147
159 Q E -1.9269
160 A E 0.0000
161 K E -1.5916
162 V E 0.0000
163 L E 0.0000
164 A E 0.0000
165 A E 0.0000
166 S E -0.4157
167 F E 0.0000
168 K E -1.4834
169 T E 0.0000
170 P E 0.0000
171 R E -0.7342
172 Q E 0.0000
173 A E 0.0000
174 L E 0.0000
175 D E -0.4669
176 C E 0.0000
177 L E 0.0000
178 L E 0.0123
179 A E -0.3015
180 G E 0.0000
181 C E 0.0000
182 E E -0.6034
183 S E 0.0000
184 I E 0.0000
185 T E 0.0000
186 L E 0.0000
187 P E -0.7755
188 L E -0.9976
189 D E -2.1472
190 V E 0.0000
191 A E 0.0000
192 Q E -1.5665
193 Q E -1.3581
194 M E 0.0000
195 I E 0.0000
196 S E -0.7883
197 Y E 0.0000
198 P E -0.9592
199 A E 0.0000
200 V E 0.0000
201 D E -1.8910
202 A E -1.1397
203 A E 0.0000
204 V E -0.9951
205 A E -1.3875
206 K E -2.0998
207 F E 0.0000
208 E E -1.9848
209 Q E -2.6264
210 D E -1.9327
211 W E 0.0000
212 Q E -2.6075
213 G E -1.8900
214 A E -1.5937
215 F E -1.2243
216 G E -1.8108
217 R E -2.3728
218 T E -1.4799
219 S E -0.2937
220 I E 0.5862
1 M F 0.1169
2 E F -0.2769
3 L F 0.0000
4 Y F 0.0000
5 L F 0.0000
6 D F -0.3681
7 T F 0.0000
8 S F -0.7691
9 D F -0.8607
10 V F -0.3321
11 V F 0.9384
12 A F 0.1202
13 V F 0.0000
14 K F -1.7727
15 A F -0.5063
16 L F -0.4123
17 S F -1.0295
18 R F -1.2152
19 I F -0.3894
20 F F 0.0000
21 P F 0.0855
22 L F -0.1859
23 A F -0.4375
24 G F 0.0000
25 V F 0.0000
26 T F 0.0000
27 T F 0.0000
28 N F -0.1154
29 P F 0.0000
30 S F -0.8290
31 I F -0.3295
32 I F 0.0000
33 A F 0.0000
34 A F -0.9416
35 G F -1.5348
36 K F -2.2144
37 K F -1.8426
38 P F -1.2045
39 L F 0.0000
40 D F -1.7562
41 V F -0.5110
42 V F 0.0000
43 L F 0.0000
44 P F -1.0199
45 Q F -1.3744
46 L F 0.0000
47 H F -2.1886
48 E F -2.8951
49 A F 0.0000
50 M F 0.0000
51 G F -2.0966
52 G F -2.2539
53 Q F -2.2521
54 G F -1.8366
55 R F -1.7037
56 L F 0.0000
57 F F 0.0000
58 A F 0.0000
59 Q F 0.0000
60 V F 0.0000
61 M F -0.2030
62 A F -0.6686
63 T F -0.4955
64 T F -0.9268
65 A F 0.0000
66 E F -2.2494
67 G F -1.3990
68 M F 0.0000
69 V F 0.0000
70 N F -1.7133
71 D F -1.0874
72 A F 0.0000
73 L F 0.1518
74 K F -1.2341
75 L F 0.0000
76 R F -0.8316
77 S F -0.7871
78 I F -0.6894
79 I F 0.0000
80 A F -0.8928
81 D F -1.9999
82 I F 0.0000
83 V F 0.0000
84 V F 0.0000
85 K F 0.0000
86 V F 0.0000
87 P F 0.0000
88 V F 0.0000
89 T F -0.3379
90 A F -0.3737
91 E F -0.6300
92 G F 0.0000
93 L F 0.0000
94 A F 0.0000
95 A F 0.0000
96 I F 0.0000
97 Y F 1.5620 mutated: KF97Y
98 M F 1.0722
99 L F 0.0000
100 Y F 1.9394 mutated: KF100Y
101 A F 1.5393
102 Y F 1.9179 mutated: EF102Y
103 G F 0.8665
104 I F 0.5277
105 P F -0.1353
106 T F 0.0000
107 L F 0.0000
108 G F 0.0000
109 T F 0.0000
110 A F 0.0000
111 V F 0.0000
112 Y F 0.0000
113 G F 0.0000
114 A F 0.0000
115 A F 0.0000
116 Q F 0.0000
117 G F 0.0000
118 L F 0.0000
119 L F 0.0000
120 S F 0.0000
121 A F 0.0000
122 L F 0.3149
123 A F 0.0000
124 G F 0.3172
125 A F 0.0000
126 E F -1.1557
127 Y F 0.0000
128 V F 0.0000
129 A F 0.0000
130 P F 0.0000
131 Y F 0.0000
132 V F 0.0000
133 N F -0.6683
134 R F -0.8345
135 I F 0.0000
136 D F 0.0000
137 A F 0.0000
138 Q F -0.6715
139 G F -0.5661
140 G F -0.7854
141 S F -0.6073
142 G F 0.0000
143 I F -0.2386
144 Q F -1.0387
145 T F 0.0000
146 V F 0.0000
147 T F -0.5861
148 D F -0.8001
149 L F 0.0000
150 H F 0.0000
151 Q F -1.1724
152 L F 0.0000
153 L F 0.0000
154 K F -2.0902
155 M F -0.6615
156 H F 0.0000
157 A F 0.0000
158 P F -1.5294
159 Q F -1.9010
160 A F 0.0000
161 K F -1.5345
162 V F 0.0000
163 L F 0.0000
164 A F 0.0000
165 A F 0.0000
166 S F -0.3700
167 F F 0.0000
168 K F -1.2033
169 T F 0.0000
170 P F 0.0000
171 R F -0.6637
172 Q F 0.0000
173 A F 0.0000
174 L F 0.0000
175 D F -0.3867
176 C F 0.0000
177 L F 0.0000
178 L F 0.0158
179 A F -0.2500
180 G F -0.4013
181 C F 0.0000
182 E F -0.4560
183 S F 0.0000
184 I F 0.0000
185 T F 0.0000
186 L F 0.0000
187 P F -0.7140
188 L F -0.9868
189 D F -2.0814
190 V F 0.0000
191 A F 0.0000
192 Q F -1.5380
193 Q F -1.2997
194 M F 0.0000
195 I F 0.0000
196 S F -0.7815
197 Y F 0.0000
198 P F -0.9719
199 A F -0.8726
200 V F 0.0000
201 D F -1.9129
202 A F -1.3688
203 A F 0.0000
204 V F -1.0509
205 A F -1.5787
206 K F -2.4443
207 F F 0.0000
208 E F -2.2208
209 Q F -2.9584
210 D F -2.6474
211 W F 0.0000
212 Q F -2.7152
213 G F -2.0996
214 A F -1.8005
215 F F -1.4536
216 G F -1.8725
217 R F -2.4528
218 T F -1.5389
219 S F -0.2965
220 I F 0.5857
1 M G 0.0596
2 E G -0.3216
3 L G 0.0000
4 Y G 0.0000
5 L G 0.0000
6 D G -0.3342
7 T G 0.0000
8 S G -0.7172
9 D G -0.7426
10 V G -0.1978
11 V G 1.0852
12 A G 0.2603
13 V G 0.0000
14 K G -1.4359
15 A G -0.3102
16 L G -0.2704
17 S G -0.8704
18 R G -1.0642
19 I G -0.3145
20 F G 0.0000
21 P G 0.0730
22 L G -0.2306
23 A G -0.5091
24 G G 0.0000
25 V G 0.0000
26 T G 0.0000
27 T G 0.0000
28 N G -0.1206
29 P G 0.0000
30 S G -0.9714
31 I G -0.3857
32 I G 0.0000
33 A G 0.0000
34 A G -1.0333
35 G G -1.4857
36 K G -2.2112
37 K G -1.8356
38 P G -1.0722
39 L G 0.0000
40 D G -1.6707
41 V G -0.3479
42 V G 0.0000
43 L G 0.0000
44 P G -0.9365
45 Q G -1.3153
46 L G 0.0000
47 H G -2.2293
48 E G -2.8869
49 A G 0.0000
50 M G 0.0000
51 G G -2.0848
52 G G -2.2078
53 Q G -2.3111
54 G G -2.0398
55 R G -1.7563
56 L G 0.0000
57 F G 0.0000
58 A G 0.0000
59 Q G 0.0000
60 V G 0.0000
61 M G 0.0000
62 A G -0.4552
63 T G -0.4492
64 T G -0.9519
65 A G 0.0000
66 E G -2.2564
67 G G -1.2989
68 M G 0.0000
69 V G 0.0000
70 N G -1.6285
71 D G -0.8999
72 A G 0.0000
73 L G -0.0096
74 K G -1.1613
75 L G 0.0000
76 R G -0.7888
77 S G -0.7596
78 I G -0.5737
79 I G -0.7692
80 A G -0.7889
81 D G -1.9477
82 I G 0.0000
83 V G 0.0000
84 V G 0.0000
85 K G 0.0000
86 V G 0.0000
87 P G 0.0000
88 V G 0.0000
89 T G -0.3869
90 A G -0.3883
91 E G -0.6902
92 G G 0.0000
93 L G 0.0000
94 A G 0.0000
95 A G 0.0000
96 I G 0.0000
97 Y G 1.3683 mutated: KG97Y
98 M G 1.0195
99 L G 0.0000
100 Y G 1.8830 mutated: KG100Y
101 A G 1.5017
102 Y G 1.7815 mutated: EG102Y
103 G G 0.8501
104 I G 0.5332
105 P G -0.1008
106 T G 0.0000
107 L G 0.0000
108 G G 0.0000
109 T G 0.0000
110 A G 0.0000
111 V G 0.0000
112 Y G 0.0000
113 G G 0.0000
114 A G 0.0000
115 A G 0.0000
116 Q G 0.0000
117 G G 0.0000
118 L G 0.0000
119 L G 0.0000
120 S G 0.0000
121 A G 0.0000
122 L G 0.2775
123 A G 0.0000
124 G G 0.2596
125 A G 0.0000
126 E G -1.1376
127 Y G 0.0000
128 V G 0.0000
129 A G 0.0000
130 P G 0.0000
131 Y G 0.0000
132 V G 0.0000
133 N G 0.0000
134 R G -0.8151
135 I G 0.0000
136 D G 0.0000
137 A G 0.0000
138 Q G -0.7330
139 G G -0.5922
140 G G -0.7686
141 S G -0.6245
142 G G 0.0000
143 I G -0.3375
144 Q G -1.1737
145 T G 0.0000
146 V G 0.0000
147 T G -0.6792
148 D G -0.8799
149 L G 0.0000
150 H G -1.2700
151 Q G -1.2334
152 L G 0.0000
153 L G 0.0000
154 K G -2.1834
155 M G -0.8299
156 H G 0.0000
157 A G -1.0100
158 P G -1.5749
159 Q G -1.9077
160 A G -1.6345
161 K G -1.5968
162 V G 0.0000
163 L G 0.0000
164 A G 0.0000
165 A G -0.1926
166 S G -0.3496
167 F G 0.0000
168 K G -1.3271
169 T G 0.0000
170 P G 0.0000
171 R G -0.7568
172 Q G 0.0000
173 A G 0.0000
174 L G 0.0000
175 D G -0.4753
176 C G 0.0000
177 L G 0.0000
178 L G 0.0221
179 A G -0.3360
180 G G -0.4882
181 C G 0.0000
182 E G -0.6743
183 S G 0.0000
184 I G 0.0000
185 T G 0.0000
186 L G 0.0000
187 P G -0.6895
188 L G -1.0013
189 D G -2.1712
190 V G 0.0000
191 A G 0.0000
192 Q G -1.6343
193 Q G -1.6744
194 M G 0.0000
195 I G 0.0000
196 S G -0.8843
197 Y G 0.0000
198 P G -0.9682
199 A G -0.8593
200 V G 0.0000
201 D G -1.8459
202 A G -1.1114
203 A G 0.0000
204 V G -0.9347
205 A G -1.3904
206 K G -2.1142
207 F G 0.0000
208 E G -2.2235
209 Q G -2.7367
210 D G -2.0417
211 W G 0.0000
212 Q G -2.8459
213 G G -2.0260
214 A G -1.7362
215 F G -1.4968
216 G G -1.9435
217 R G -2.6462
218 T G -1.7204
219 S G -0.5644
220 I G 0.1082
1 M H 0.0878
2 E H -0.3672
3 L H 0.0000
4 Y H 0.0000
5 L H 0.0000
6 D H -0.3355
7 T H 0.0000
8 S H -0.7148
9 D H -0.8040
10 V H -0.1968
11 V H 1.0702
12 A H 0.2466
13 V H 0.0000
14 K H -1.5067
15 A H -0.3521
16 L H -0.2984
17 S H -0.8991
18 R H -1.0787
19 I H -0.3055
20 F H 0.0000
21 P H 0.1658
22 L H -0.1703
23 A H -0.5352
24 G H 0.0000
25 V H 0.0000
26 T H 0.0000
27 T H 0.0000
28 N H -0.1202
29 P H 0.0000
30 S H -0.8652
31 I H -0.2961
32 I H 0.0000
33 A H 0.0000
34 A H -0.9194
35 G H -1.5092
36 K H -2.2253
37 K H -1.9563
38 P H -1.1177
39 L H 0.0000
40 D H -1.5833
41 V H -0.3897
42 V H 0.0000
43 L H 0.0000
44 P H -0.9664
45 Q H -1.3483
46 L H 0.0000
47 H H -2.2795
48 E H -2.9231
49 A H 0.0000
50 M H 0.0000
51 G H -2.1389
52 G H -2.2879
53 Q H -2.3779
54 G H -2.1627
55 R H -1.9767
56 L H 0.0000
57 F H 0.0000
58 A H 0.0000
59 Q H 0.0000
60 V H 0.0000
61 M H 0.0000
62 A H -0.5780
63 T H -0.4377
64 T H -0.9451
65 A H 0.0000
66 E H -2.2635
67 G H -1.4655
68 M H 0.0000
69 V H 0.0000
70 N H -1.7058
71 D H -1.0475
72 A H 0.0000
73 L H -0.0311
74 K H -1.2351
75 L H 0.0000
76 R H -0.8087
77 S H -0.7671
78 I H -0.5799
79 I H -0.8064
80 A H -0.8009
81 D H -1.9948
82 I H 0.0000
83 V H 0.0000
84 V H 0.0000
85 K H 0.0000
86 V H 0.0000
87 P H 0.0000
88 V H 0.0000
89 T H -0.3989
90 A H -0.3726
91 E H -0.7704
92 G H 0.0000
93 L H 0.0000
94 A H 0.0000
95 A H 0.0000
96 I H 0.0000
97 Y H 1.3180 mutated: KH97Y
98 M H 0.9581
99 L H 0.0000
100 Y H 1.8188 mutated: KH100Y
101 A H 1.4733
102 Y H 1.7762 mutated: EH102Y
103 G H 0.8483
104 I H 0.5068
105 P H -0.1631
106 T H 0.0000
107 L H 0.0000
108 G H 0.0000
109 T H 0.0000
110 A H 0.0000
111 V H 0.0000
112 Y H 0.0000
113 G H 0.0000
114 A H 0.0000
115 A H 0.0000
116 Q H 0.0000
117 G H 0.0000
118 L H 0.0000
119 L H 0.0000
120 S H 0.0000
121 A H -0.3982
122 L H 0.2345
123 A H 0.0000
124 G H 0.1435
125 A H 0.0000
126 E H -1.3690
127 Y H 0.0000
128 V H 0.0000
129 A H 0.0000
130 P H 0.0000
131 Y H 0.0000
132 V H 0.0000
133 N H 0.0000
134 R H -0.7867
135 I H 0.0000
136 D H 0.0000
137 A H 0.0000
138 Q H -0.6411
139 G H -0.5511
140 G H -0.7704
141 S H -0.6161
142 G H 0.0000
143 I H -0.2747
144 Q H -1.0782
145 T H 0.0000
146 V H 0.0000
147 T H -0.5524
148 D H 0.0000
149 L H 0.0000
150 H H -1.1929
151 Q H -1.1457
152 L H 0.0000
153 L H 0.0000
154 K H -2.1643
155 M H -0.8578
156 H H 0.0000
157 A H 0.0000
158 P H -1.5865
159 Q H -1.9679
160 A H 0.0000
161 K H -1.6757
162 V H 0.0000
163 L H 0.0000
164 A H 0.0000
165 A H -0.1934
166 S H -0.3503
167 F H 0.0000
168 K H -1.2686
169 T H 0.0000
170 P H 0.0000
171 R H -0.6964
172 Q H 0.0000
173 A H 0.0000
174 L H 0.0000
175 D H -0.4333
176 C H 0.0000
177 L H 0.0000
178 L H 0.0989
179 A H -0.2165
180 G H 0.0000
181 C H 0.0000
182 E H -0.5767
183 S H 0.0000
184 I H 0.0000
185 T H 0.0000
186 L H 0.0000
187 P H -0.7052
188 L H -0.9850
189 D H -2.1106
190 V H 0.0000
191 A H 0.0000
192 Q H -1.5461
193 Q H -1.3049
194 M H 0.0000
195 I H 0.0000
196 S H -0.7862
197 Y H 0.0000
198 P H -0.9360
199 A H -0.8633
200 V H 0.0000
201 D H -1.8434
202 A H -1.0998
203 A H 0.0000
204 V H -0.9278
205 A H -1.3642
206 K H -2.0418
207 F H 0.0000
208 E H -2.0087
209 Q H -2.6202
210 D H -1.9304
211 W H 0.0000
212 Q H -2.5076
213 G H -1.8677
214 A H -1.5883
215 F H -1.1805
216 G H -1.5362
217 R H -1.9706
218 T H -1.4872
219 S H -0.7053
220 I H -0.4417
1 M I 0.1012
2 E I -0.3002
3 L I 0.0000
4 Y I 0.0000
5 L I 0.0000
6 D I -0.3781
7 T I 0.0000
8 S I -0.7403
9 D I -0.9061
10 V I -0.3768
11 V I 0.9296
12 A I 0.1227
13 V I 0.0000
14 K I -1.8148
15 A I -0.4686
16 L I -0.3618
17 S I -0.9681
18 R I -1.1517
19 I I -0.3430
20 F I 0.0000
21 P I 0.1224
22 L I -0.2429
23 A I -0.4812
24 G I 0.0000
25 V I 0.0000
26 T I 0.0000
27 T I 0.0000
28 N I -0.1314
29 P I 0.0000
30 S I -0.8390
31 I I -0.3085
32 I I 0.0000