Project name: 66d65ba551dca2d

Status: done

submitted: 2017-11-14 10:16:03, status changed: 2017-11-14 11:42:43
Settings
Chain sequence(s) A: DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCCIIWLAFVPFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCCIIWLAFVPFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7597
Maximal score value
2.12
Average score
-0.7661
Total score value
-1021.9655

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.5196
2 I A 0.9810
3 V A 0.0000
4 M A 0.6266
5 T A 0.0000
6 Q A -0.7982
7 T A -0.1902
8 P A 0.1368
9 L A 0.9975
10 S A 0.1741
11 L A -0.0554
12 P A -0.6409
13 V A 0.0000
14 T A -1.7436
15 P A -1.9224
16 G A -2.0279
17 E A -2.0602
18 P A -1.8067
19 A A -1.1922
20 S A -0.9125
21 I A 0.0000
22 S A -0.8498
23 C A 0.0000
24 R A -1.1883
25 S A 0.0000
26 S A -1.0054
27 K A -2.3792
28 S A -1.7096
29 L A 0.0000
30 L A -0.1111
31 H A -1.2838
32 S A -1.2452
33 N A -1.4960
34 G A -0.6477
35 I A 1.0989
36 T A 0.0000
37 Y A 0.7890
38 L A 0.0000
39 Y A 0.0000
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A -1.0026
44 K A -1.3194
45 P A -1.3291
46 G A -1.4262
47 Q A -2.0572
48 S A -1.3754
49 P A 0.0000
50 Q A -0.9555
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A -0.0059
55 Q A -0.3853
56 M A 0.2175
57 S A -0.3932
58 N A -0.9724
59 L A -0.3669
60 V A -0.0987
61 S A -0.2833
62 G A -0.5072
63 V A -0.4570
64 P A -0.9427
65 D A -1.8911
66 R A -1.8289
67 F A 0.0000
68 S A -0.9839
69 G A 0.0000
70 S A -0.5632
71 G A -0.3577
72 S A -0.3291
73 G A -0.8908
74 T A -1.3818
75 D A -1.5766
76 F A 0.0000
77 T A -0.8121
78 L A 0.0000
79 K A -1.4960
80 I A 0.0000
81 S A -2.2020
82 R A -2.9727
83 V A 0.0000
84 E A -2.0037
85 A A -1.3199
86 E A -1.2721
87 D A 0.0000
88 V A -0.7683
89 G A 0.0000
90 V A -0.4032
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 C A 0.0000
95 I A 0.0000
96 I A 0.0000
97 W A 0.8040
98 L A 1.4563
99 A A 0.7495
100 F A 0.8741
101 V A 0.0000
102 P A 0.4067
103 F A 0.0000
104 G A 0.0000
105 G A -0.4073
106 G A -0.5249
107 T A 0.0000
108 K A -0.6180
109 V A 0.0000
110 E A -0.9478
111 I A 0.0000
112 K A -1.6955
113 R A -2.0682
114 T A -0.4260
115 V A 0.5832
116 A A 0.1286
117 A A -0.0167
118 P A -0.4347
119 S A -0.3955
120 V A 0.0000
121 F A 0.0977
122 I A 0.0000
123 F A 0.0000
124 P A -0.4708
125 P A 0.0000
126 S A -1.7215
127 D A -3.0445
128 E A -2.8695
129 Q A 0.0000
130 L A -1.9767
131 K A -2.9342
132 S A -1.6863
133 G A -1.1100
134 T A -0.6481
135 A A 0.0000
136 S A 0.0000
137 V A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 L A 0.0000
142 N A -0.4388
143 N A -1.2968
144 F A 0.0000
145 Y A 0.0000
146 P A -1.8844
147 R A -3.2293
148 E A -3.3137
149 A A -2.5238
150 K A -2.6241
151 V A -1.2155
152 Q A -0.9255
153 W A 0.0000
154 K A -0.6295
155 V A 0.0000
156 D A -1.5791
157 N A -1.2741
158 A A -0.3462
159 L A 0.3516
160 Q A -0.9816
161 S A -0.7999
162 G A -1.2521
163 N A -1.9537
164 S A -1.5397
165 Q A -1.2585
166 E A -1.8409
167 S A 0.0000
168 V A -0.6992
169 T A -1.1627
170 E A -2.3428
171 Q A -2.4472
172 D A -2.7076
173 S A -2.3626
174 K A -2.9265
175 D A -3.3206
176 S A 0.0000
177 T A -2.2362
178 Y A 0.0000
179 S A 0.0000
180 L A 0.0000
181 S A 0.0000
182 S A 0.0000
183 T A 0.0000
184 L A 0.0000
185 T A -0.5168
186 L A -0.4445
187 S A -0.7424
188 K A -1.3608
189 A A -1.2861
190 D A -1.4337
191 Y A 0.0000
192 E A -2.0618
193 K A -2.7789
194 H A -2.3465
195 K A -2.4033
196 V A -1.2817
197 Y A 0.0000
198 A A -0.9493
199 C A 0.0000
200 E A -0.9324
201 V A 0.0000
202 T A -1.1166
203 H A 0.0000
204 Q A -1.8353
205 G A -0.4683
206 L A -0.0404
207 S A -0.3966
208 S A -0.3169
209 P A -0.4255
210 V A 0.0347
211 T A -0.5260
212 K A -0.9658
213 S A -0.8090
214 F A 0.0000
215 N A -1.8873
216 R A -1.9513
217 G A -1.5760
218 E A -1.8403
219 C A -1.5779
220 Q B -1.3182
221 V B -0.4072
222 Q B -1.3995
223 L B 0.0000
224 V B -0.7217
225 Q B 0.0000
226 S B -0.8916
227 G B -0.8169
228 A B 0.0000
229 E B -1.0154
230 V B -0.4238
231 K B 0.0000
232 K B -2.0857
233 P B -2.0638
234 G B -1.7437
235 S B -1.2288
236 S B -1.2080
237 V B -1.0131
238 K B -1.6779
239 V B 0.0000
240 S B -1.0579
241 C B 0.0000
242 K B -1.8454
243 A B -1.2764
244 S B -0.9968
245 G B -0.7502
246 Y B 0.1420
247 A B 0.4053
248 F B 0.0000
249 S B -0.0662
250 Y B 1.2861
251 S B 0.0000
252 W B 0.4772
253 I B 0.0000
254 N B 0.0000
255 W B 0.0000
256 V B 0.0000
257 R B 0.0000
258 Q B -0.7351
259 A B -0.9760
260 P B -0.9240
261 G B -1.2454
262 Q B -1.8480
263 G B -1.2896
264 L B 0.0000
265 E B -1.2843
266 W B 0.0000
267 M B 0.0000
268 G B 0.0000
269 R B -0.9025
270 I B 0.0000
271 F B -0.8305
272 P B -0.4863
273 G B -1.4257
274 D B -2.7157
275 G B -2.3491
276 D B -2.7630
277 T B -1.9587
278 D B -1.8618
279 Y B -1.6539
280 N B -1.5360
281 G B -2.0982
282 K B -3.2785
283 F B 0.0000
284 K B -3.2787
285 G B -2.3805
286 R B -3.1860
287 V B 0.0000
288 T B -1.3460
289 I B 0.0000
290 T B -0.7184
291 A B -1.0587
292 D B -1.7896
293 K B -1.6009
294 S B -0.9823
295 T B -1.0289
296 S B -1.1992
297 T B 0.0000
298 A B 0.0000
299 Y B -0.8215
300 M B 0.0000
301 E B -1.8503
302 L B 0.0000
303 S B -1.6655
304 S B -1.6813
305 L B 0.0000
306 R B -3.4284
307 S B -2.4592
308 E B -2.8641
309 D B -2.0138
310 T B -0.8890
311 A B 0.0000
312 V B 0.4304
313 Y B 0.0000
314 Y B 0.0000
315 C B 0.0000
316 A B 0.0000
317 R B 0.3835
318 N B 0.6695
319 V B 1.5403
320 F B 0.6810
321 D B -0.1575
322 G B 0.0000
323 Y B 0.0000
324 W B 0.0000
325 L B 0.0000
326 V B 0.5823
327 Y B 0.3949
328 W B 0.0000
329 G B 0.0000
330 Q B -1.2815
331 G B -0.4074
332 T B 0.0939
333 L B 0.9146
334 V B 0.0000
335 T B -0.4651
336 V B 0.0000
337 S B -1.1653
338 S B -0.9002
339 A B -0.7921
340 S B -1.0401
341 T B -1.2370
342 K B -2.2530
343 G B -1.9236
344 P B -1.0316
345 S B -0.7179
346 V B 0.0000
347 F B 0.0000
348 P B -1.3657
349 L B 0.0000
350 A B -0.9495
351 P B -0.7821
352 S B -1.2047
353 S B -1.3509
354 K B -1.9697
355 S B -1.4480
356 T B -1.0063
357 S B -0.9274
358 G B -0.9156
359 G B -0.9429
360 T B -0.6565
361 A B 0.0000
362 A B -0.0364
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.5488
369 D B -1.1930
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -0.8070
374 P B -0.6605
375 V B -0.7947
376 T B -0.5303
377 V B -0.2844
378 S B -0.3384
379 W B 0.0000
380 N B -0.8325
381 S B -0.6729
382 G B -0.4054
383 A B -0.2082
384 L B -0.0028
385 T B -0.1379
386 S B -0.1314
387 G B -0.0825
388 V B 0.2418
389 H B -0.2600
390 T B 0.0177
391 F B 0.0000
392 P B -0.2433
393 A B 0.3042
394 V B 0.5059
395 L B 0.6824
396 Q B -0.4610
397 S B -0.3980
398 S B -0.3895
399 G B -0.8100
400 L B -0.5510
401 Y B -0.2063
402 S B 0.0000
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.1392
409 V B 0.0000
410 P B -0.6692
411 S B -0.7119
412 S B -0.7515
413 S B -0.8300
414 L B 0.0000
415 G B -1.2504
416 T B -0.9591
417 Q B -1.4187
418 T B -1.3718
419 Y B 0.0000
420 I B -1.4460
421 C B 0.0000
422 N B -1.5938
423 V B 0.0000
424 N B -1.9753
425 H B 0.0000
426 K B -2.7013
427 P B -1.8824
428 S B -2.0001
429 N B -2.5063
430 T B -2.1327
431 K B -2.5959
432 V B -1.7657
433 D B -2.6071
434 K B -2.2076
435 K B -2.7571
436 V B 0.0000
437 E B -2.8694
438 P B -2.1612
439 K B -2.4431
440 S B -1.5170
441 C B -1.0394
442 D B -1.1137
443 K B -1.3331
444 T B -1.1413
445 H B -1.2564
446 T B -0.6510
447 C B -1.0206
448 P B -0.8758
449 P B -0.5999
450 C B -0.6191
451 P B -0.7808
452 A B -0.6730
453 P B -0.8712
454 E B -1.2500
455 L B 0.2325
456 L B 0.5348
457 G B -0.0505
458 G B -0.2405
459 P B 0.0000
460 S B 0.1926
461 V B 0.0000
462 F B 2.1140
463 L B 0.0000
464 F B 2.1200
465 P B 0.3888
466 P B 0.0000
467 K B -2.1857
468 P B -1.5470
469 K B -1.5795
470 D B -1.7042
471 T B 0.0000
472 L B 0.0000
473 M B 0.5182
474 I B 1.4050
475 S B -0.0482
476 R B -1.4710
477 T B -0.8793
478 P B 0.0000
479 E B -1.3149
480 V B 0.0000
481 T B 0.9021
482 C B 0.0000
483 V B 0.6815
484 V B 0.0000
485 V B 0.2812
486 D B -0.6668
487 V B 0.0000
488 S B -1.6314
489 H B -2.1141
490 E B -2.8160
491 D B -2.2159
492 P B -2.3077
493 E B -2.6496
494 V B 0.0000
495 K B -2.5114
496 F B 0.0000
497 N B -1.7419
498 W B 0.0000
499 Y B -1.3307
500 V B -0.9469
501 D B -2.1923
502 G B -0.8597
503 V B 0.5957
504 E B -0.9344
505 V B 0.2082
506 H B -1.2284
507 N B -1.2911
508 A B -1.0430
509 K B -2.1434
510 T B 0.0000
511 K B -2.5144
512 P B -2.0674
513 R B -3.2273
514 E B -2.7010
515 E B -2.5751
516 Q B -2.1513
517 Y B -0.8218
518 N B -1.2739
519 S B -0.8057
520 T B -1.1079
521 Y B -1.6415
522 R B -1.5204
523 V B 0.0000
524 V B -0.8525
525 S B 0.0000
526 V B -0.0151
527 L B 0.0000
528 T B -0.5081
529 V B 0.2456
530 L B 0.7876
531 H B 0.0000
532 Q B -1.0961
533 D B -1.2237
534 W B 0.0000
535 L B -0.9657
536 N B -2.0774
537 G B -2.2090
538 K B -2.3581
539 E B -2.3062
540 Y B 0.0000
541 K B -1.9356
542 C B 0.0000
543 K B -1.8499
544 V B 0.0000
545 S B -1.4813
546 N B -1.8135
547 K B -2.0911
548 A B -1.2509
549 L B -0.5789
550 P B -0.4261
551 A B -0.3545
552 P B -0.5333
553 I B -0.4698
554 E B -1.4113
555 K B -1.2634
556 T B -1.0054
557 I B -0.0073
558 S B -1.5524
559 K B -1.3777
560 A B -1.2802
561 K B -2.3127
562 G B -2.1316
563 Q B -2.4238
564 P B -2.4145
565 R B -3.0909
566 E B -3.0336
567 P B 0.0000
568 Q B -1.2293
569 V B 0.0000
570 Y B 0.0000
571 T B -0.8318
572 L B 0.0000
573 P B -0.4302
574 P B -0.7140
575 S B -1.2642
576 R B -2.3687
577 D B -2.5719
578 E B 0.0000
579 L B -0.6883
580 T B -1.3701
581 K B -2.7203
582 N B -2.7869
583 Q B -2.5802
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B 0.0000
592 G B -1.0506
593 F B 0.0000
594 Y B -1.4116
595 P B 0.0000
596 S B -0.0284
597 D B -0.9776
598 I B 0.0000
599 A B -0.7302
600 V B -0.8306
601 E B -1.9719
602 W B 0.0000
603 E B -2.1965
604 S B -1.9888
605 N B -2.2568
606 G B -1.9576
607 Q B -2.3035
608 P B -2.2749
609 E B -2.5998
610 N B -2.3159
611 N B -1.7125
612 Y B -1.2403
613 K B -0.8608
614 T B -0.5325
615 T B 0.0000
616 P B 0.0053
617 P B 0.2792
618 V B 0.7734
619 L B 0.8977
620 D B -0.2475
621 S B -1.1507
622 D B -1.8921
623 G B -0.7844
624 S B -0.7356
625 F B 0.1752
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.9326
633 V B 0.0000
634 D B -2.6389
635 K B -2.7396
636 S B -2.5012
637 R B -3.0213
638 W B -2.2926
639 Q B -2.6661
640 Q B -2.6927
641 G B -1.8502
642 N B -1.6542
643 V B -0.9440
644 F B 0.0000
645 S B -1.3515
646 C B 0.0000
647 S B 0.0000
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.2134
652 A B -2.0127
653 L B 0.0000
654 H B -1.7816
655 N B -1.6821
656 H B -1.1784
657 Y B -0.5384
658 T B -1.1137
659 Q B -1.5791
660 K B -1.3838
661 S B -0.8140
662 L B 0.0000
663 S B -0.6755
664 L B 0.0000
665 S B -0.8614
666 P B -0.7283
667 G B -1.1240
668 D C -0.5503
669 I C 0.5455
670 V C 0.0000
671 M C -0.4662
672 T C 0.0000
673 Q C -1.3941
674 T C -0.4616
675 P C -0.2425
676 L C 0.7860
677 S C -0.2708
678 L C -0.3884
679 P C -0.7297
680 V C 0.0000
681 T C -1.7969
682 P C -2.0177
683 G C -2.2320
684 E C -2.3007
685 P C -1.9406
686 A C 0.0000
687 S C -1.1159
688 I C 0.0000
689 S C -1.4095
690 C C 0.0000
691 R C -2.5124
692 S C 0.0000
693 S C -1.4046
694 K C -2.1554
695 S C -1.2344
696 L C 0.0000
697 L C 0.3274
698 H C -0.6595
699 S C -0.5105
700 N C -1.1770
701 G C -0.2003
702 I C 0.4505
703 T C 0.0000
704 Y C 0.7500
705 L C 0.0000
706 Y C 0.0000
707 W C 0.0000
708 Y C 0.0000
709 L C 0.0000
710 Q C -1.2425
711 K C -1.7699
712 P C -1.4114
713 G C -1.6467
714 Q C -2.1368
715 S C -1.5094
716 P C 0.0000
717 Q C -1.1084
718 L C 0.0000
719 L C 0.0000
720 I C 0.0000
721 Y C 0.3715
722 Q C 0.1003
723 M C 0.3676
724 S C -0.2518
725 N C -0.8531
726 L C -0.2710
727 V C -0.0255
728 S C -0.2700
729 G C -0.5048
730 V C -0.4555
731 P C -1.1119
732 D C -1.8734
733 R C -1.8320
734 F C 0.0000
735 S C -1.1125
736 G C -0.5715
737 S C -0.6618
738 G C -0.6289
739 S C -0.2963
740 G C 0.0000
741 T C -1.6283
742 D C -2.2448
743 F C 0.0000
744 T C -1.1622
745 L C 0.0000
746 K C -1.8273
747 I C 0.0000
748 S C -2.2532
749 R C -3.0677
750 V C 0.0000
751 E C -2.2486
752 A C -1.7231
753 E C -2.1090
754 D C 0.0000
755 V C -1.1859
756 G C 0.0000
757 V C -0.8173
758 Y C 0.0000
759 Y C 0.0000
760 C C 0.0000
761 C C 0.0000
762 I C 0.0000
763 I C 0.9308
764 W C 1.0253
765 L C 1.6033
766 A C 1.0704
767 F C 1.1170
768 V C 0.0000
769 P C 0.5347
770 F C 0.0000
771 G C 0.0000
772 G C -0.6746
773 G C -0.8573
774 T C 0.0000
775 K C -1.4881
776 V C 0.0000
777 E C -1.2087
778 I C 0.0000
779 K C -1.5472
780 R C -1.3395
781 T C 0.0024
782 V C 1.0607
783 A C 0.3941
784 A C 0.0962
785 P C -0.2942
786 S C -0.2476
787 V C -0.0432
788 F C 0.1499
789 I C 0.0000
790 F C 0.0000
791 P C 0.0000
792 P C 0.0000
793 S C 0.0000
794 D C -3.0245
795 E C -3.0259
796 Q C 0.0000
797 L C -2.2197
798 K C -2.7779
799 S C -1.7430
800 G C -1.2037
801 T C -0.8701
802 A C 0.0000
803 S C 0.0000
804 V C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 L C 0.0000
809 N C 0.0000
810 N C -0.9013
811 F C 0.0000
812 Y C 0.0000
813 P C 0.0000
814 R C -3.2100
815 E C -3.3072
816 A C -2.5484
817 K C -2.5657
818 V C -1.3404
819 Q C -1.0414
820 W C 0.0000
821 K C -0.3272
822 V C -0.5874
823 D C -1.2751
824 N C -1.2184
825 A C -0.1538
826 L C 0.7124
827 Q C -0.4468
828 S C -0.6330
829 G C -1.2107
830 N C -2.0163
831 S C -1.6616
832 Q C -1.3787
833 E C -1.8952
834 S C -0.6797
835 V C -0.7538
836 T C -1.1254
837 E C -2.3609
838 Q C -2.2192
839 D C -2.2471
840 S C -2.2148
841 K C -2.3603
842 D C -2.0705
843 S C -2.0905
844 T C 0.0000
845 Y C 0.0000
846 S C 0.0000
847 L C 0.0000
848 S C 0.0000
849 S C 0.0000
850 T C 0.0000
851 L C 0.0000
852 T C -0.5966
853 L C -0.6603
854 S C -1.2306
855 K C -2.2091
856 A C -2.1593
857 D C -2.4843
858 Y C 0.0000
859 E C -3.7597
860 K C -3.6053
861 H C -3.0528
862 K C -3.0888
863 V C -1.2799
864 Y C 0.0000
865 A C -0.8464
866 C C 0.0000
867 E C -1.1877
868 V C 0.0000
869 T C -1.2509
870 H C 0.0000
871 Q C -1.7850
872 G C -0.4329
873 L C -0.1640
874 S C -0.4516
875 S C -0.3627
876 P C -0.5645
877 V C -0.0530
878 T C -0.6460
879 K C -0.9496
880 S C -0.7614
881 F C 0.0000
882 N C -1.6937
883 R C -2.1235
884 G C -1.7087
885 E C -1.4907
886 C C -0.6474
887 Q D -1.1379
888 V D -0.6065
889 Q D -1.1434
890 L D 0.0000
891 V D 0.1185
892 Q D -0.2903
893 S D -0.7519
894 G D -1.0454
895 A D 0.0000
896 E D -1.4898
897 V D -0.9145
898 K D -1.5697
899 K D -2.2824
900 P D -2.0428
901 G D -1.6631
902 S D -1.2465
903 S D -1.2445
904 V D -1.3640
905 K D -1.9658
906 V D 0.0000
907 S D 0.0000
908 C D 0.0000
909 K D -0.7952
910 A D 0.0000
911 S D -0.6365
912 G D -0.6316
913 Y D 0.0727
914 A D 0.2928
915 F D 0.0000
916 S D 0.0382
917 Y D 1.3496
918 S D 0.0000
919 W D 0.7153
920 I D 0.0000
921 N D 0.0000
922 W D 0.0000
923 V D 0.0000
924 R D 0.0000
925 Q D -0.5746
926 A D -0.9154
927 P D -0.9282
928 G D -1.2385
929 Q D -1.7471
930 G D -1.1001
931 L D -0.5560
932 E D -0.5759
933 W D 0.0000
934 M D 0.0000
935 G D 0.0000
936 R D -0.5866
937 I D 0.0000
938 F D -0.5311
939 P D -0.2934
940 G D -1.2387
941 D D -2.5853
942 G D -2.2360
943 D D -2.5715
944 T D -1.5872
945 D D -1.1644
946 Y D -0.3317
947 N D -0.7771
948 G D -1.3874
949 K D -2.3983
950 F D 0.0000
951 K D -2.5505
952 G D -1.8032
953 R D -2.3684
954 V D 0.0000
955 T D -1.1578
956 I D 0.0000
957 T D -0.7108
958 A D -0.9773
959 D D -1.6051
960 K D -1.6264
961 S D -0.9918
962 T D -0.9014
963 S D -1.0074
964 T D 0.0000
965 A D 0.0000
966 Y D -0.7862
967 M D 0.0000
968 E D -1.9842
969 L D 0.0000
970 S D -1.3817
971 S D -1.2601
972 L D 0.0000
973 R D -2.9305
974 S D -2.2607
975 E D -2.6058
976 D D 0.0000
977 T D -0.9388
978 A D 0.0000
979 V D 0.1379
980 Y D 0.0000
981 Y D 0.0000
982 C D 0.0000
983 A D 0.0000
984 R D 0.2750
985 N D 0.7129
986 V D 1.4136
987 F D 0.9913
988 D D 0.0000
989 G D 0.0000
990 Y D 0.0000
991 W D 0.0000
992 L D 0.0000
993 V D 0.4779
994 Y D -0.0247
995 W D 0.0000
996 G D 0.0000
997 Q D -1.2375
998 G D -0.4940
999 T D -0.2187
1000 L D 0.1799
1001 V D 0.0000
1002 T D -0.7505
1003 V D 0.0000
1004 S D -1.2505
1005 S D -1.0070
1006 A D -0.6385
1007 S D -0.7231
1008 T D -0.6179
1009 K D -1.0228
1010 G D -1.3768
1011 P D -0.7265
1012 S D -0.5933
1013 V D 0.0000
1014 F D 0.0000
1015 P D -1.3907
1016 L D 0.0000
1017 A D 0.0000
1018 P D -0.7353
1019 S D 0.0000
1020 S D -1.2651
1021 K D -2.0260
1022 S D -1.2827
1023 T D -1.0258
1024 S D -0.9417
1025 G D -0.9151
1026 G D -0.9414
1027 T D -0.6360
1028 A D 0.0000
1029 A D 0.0300
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.5043
1036 D D -0.7656
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.5375
1041 P D -0.6265
1042 V D -0.6416
1043 T D -0.5532
1044 V D -0.1001
1045 S D -0.2228
1046 W D 0.0000
1047 N D -0.6874
1048 S D -0.5561
1049 G D -0.3709
1050 A D -0.1922
1051 L D 0.0090
1052 T D -0.0740
1053 S D -0.0733
1054 G D -0.0143
1055 V D 0.4926
1056 H D -0.0596
1057 T D 0.0982
1058 F D 0.0000
1059 P D -0.2169
1060 A D 0.2770
1061 V D 0.7501
1062 L D 1.2406
1063 Q D -0.3482
1064 S D -0.2970
1065 S D -0.3278
1066 G D 0.0000
1067 L D 0.0372
1068 Y D 0.2688
1069 S D 0.0000
1070 L D 0.0000
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0626
1076 V D 0.0000
1077 P D -0.6379
1078 S D -0.6867
1079 S D -0.6991
1080 S D -0.7470
1081 L D -0.9117
1082 G D -1.1791
1083 T D -0.9088
1084 Q D -1.3359
1085 T D -1.3173
1086 Y D 0.0000
1087 I D -1.2830
1088 C D 0.0000
1089 N D -1.2184
1090 V D 0.0000
1091 N D -1.9854
1092 H D 0.0000
1093 K D -2.7095
1094 P D -1.7711
1095 S D -1.8109
1096 N D -2.5542
1097 T D -2.1079
1098 K D -2.5090
1099 V D -1.4333
1100 D D -1.9497
1101 K D -1.7713
1102 K D -2.5758
1103 V D 0.0000
1104 E D -2.6340
1105 P D -1.6609
1106 K D -1.5424
1107 S D -1.4834
1108 C D -0.8731
1109 D D -1.7010
1110 K D -2.0824
1111 T D -1.4229
1112 H D -1.2593
1113 T D 0.0000
1114 C D -1.2157
1115 P D -1.2651
1116 P D -1.0727
1117 C D -0.6961
1118 P D -0.6943
1119 A D 0.0000
1120 P D -0.9346
1121 E D -1.4733
1122 L D -0.1894
1123 L D 1.0804
1124 G D -0.0022
1125 G D -0.0854
1126 P D -0.1684
1127 S D 0.1496
1128 V D 0.0000
1129 F D 1.2870
1130 L D 1.0653
1131 F D 1.5265
1132 P D 0.2322
1133 P D 0.0000
1134 K D -1.9647
1135 P D -1.3002
1136 K D -1.0620
1137 D D 0.0000
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.7411
1141 I D 1.7080
1142 S D 0.1709
1143 R D -0.8464
1144 T D -0.3951
1145 P D 0.0000
1146 E D -0.6697
1147 V D 0.0000
1148 T D 0.8622
1149 C D 0.0000
1150 V D 0.0000
1151 V D 0.0000
1152 V D 0.0499
1153 D D -0.4839
1154 V D 0.0000
1155 S D -1.9027
1156 H D -2.3680
1157 E D -2.8307
1158 D D -2.2309
1159 P D -2.1715
1160 E D -2.2768
1161 V D 0.0000
1162 K D -2.3609
1163 F D 0.0000
1164 N D -1.5041
1165 W D 0.0000
1166 Y D -0.9580
1167 V D -0.7568
1168 D D -2.0467
1169 G D -0.6503
1170 V D 0.9583
1171 E D -0.1215
1172 V D 0.3886
1173 H D -1.1632
1174 N D -1.0618
1175 A D -1.0380
1176 K D -2.0664
1177 T D 0.0000
1178 K D -2.1376
1179 P D -2.1756
1180 R D -2.9179
1181 E D -3.0512
1182 E D -2.8543
1183 Q D -1.6553
1184 Y D -0.3528
1185 N D -0.4623
1186 S D -0.6971
1187 T D 0.0000
1188 Y D 0.0000
1189 R D -1.9431
1190 V D 0.0000
1191 V D -0.8455
1192 S D 0.0000
1193 V D 0.2922
1194 L D 0.0000
1195 T D 0.0232
1196 V D 0.6130
1197 L D 1.1614
1198 H D 0.0000
1199 Q D -0.8425
1200 D D -0.8879
1201 W D 0.0000
1202 L D -0.8483
1203 N D -1.8253
1204 G D -2.1676
1205 K D -2.3214
1206 E D -2.3826
1207 Y D 0.0000
1208 K D -1.9591
1209 C D 0.0000
1210 K D -1.8769
1211 V D 0.0000
1212 S D -1.3894
1213 N D -1.7487
1214 K D -2.0878
1215 A D -1.2964
1216 L D -0.6190
1217 P D -0.4887
1218 A D -0.3654
1219 P D -0.5522
1220 I D -0.5807
1221 E D -1.6769
1222 K D -1.3791
1223 T D -1.1934
1224 I D -0.0536
1225 S D -1.5551
1226 K D -1.4293
1227 A D -1.2857
1228 K D -2.3381
1229 G D -2.1193
1230 Q D -2.4036
1231 P D -2.3455
1232 R D -3.0934
1233 E D -3.0904
1234 P D 0.0000
1235 Q D -1.4446
1236 V D 0.0000
1237 Y D 0.0000
1238 T D 0.0000
1239 L D 0.0000
1240 P D -0.3813
1241 P D 0.0000
1242 S D -1.4150
1243 R D -2.5821
1244 D D -2.7399
1245 E D 0.0000
1246 L D -1.3582
1247 T D -1.5358
1248 K D -2.5862
1249 N D -2.7892
1250 Q D -2.6879
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D -0.6866
1259 G D -1.2147
1260 F D 0.0000
1261 Y D -1.4327
1262 P D 0.0000
1263 S D -0.0264
1264 D D -0.9197
1265 I D 0.0000
1266 A D -0.4286
1267 V D -0.1238
1268 E D -0.6734
1269 W D 0.0000
1270 E D -1.7355
1271 S D 0.0000
1272 N D -2.1131
1273 G D -1.8716
1274 Q D -2.2425
1275 P D -1.9825
1276 E D -2.2221
1277 N D -1.8915
1278 N D -1.2723
1279 Y D -0.6330
1280 K D -0.3555
1281 T D -0.1936
1282 T D 0.0000
1283 P D 0.0060
1284 P D 0.2245
1285 V D 0.7144
1286 L D 0.8916
1287 D D -0.4390
1288 S D -1.3284
1289 D D -2.0009
1290 G D -0.9145
1291 S D -0.8618
1292 F D 0.0000
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D 0.0000
1300 V D 0.0000
1301 D D -2.5677
1302 K D -2.4632
1303 S D -2.1013
1304 R D -2.3046
1305 W D -1.9586
1306 Q D -2.4764
1307 Q D -2.4255
1308 G D -1.4430
1309 N D -1.5135
1310 V D -0.3820
1311 F D 0.0000
1312 S D 0.0000
1313 C D 0.0000
1314 S D 0.0000
1315 V D 0.0000
1316 M D 0.0000
1317 H D 0.0000
1318 E D -1.2423
1319 A D -2.0073
1320 L D 0.0000
1321 H D -1.8370
1322 N D -1.7401
1323 H D -0.9537
1324 Y D -0.6360
1325 T D -0.9596
1326 Q D -0.9493
1327 K D -1.0575
1328 S D -0.2658
1329 L D 0.0000
1330 S D 0.0000
1331 L D 1.3087
1332 S D 0.3777
1333 P D -0.5218
1334 G D -0.8829

 

Laboratory of Theory of Biopolymers 2015