Project name: 699f651dc18616b

Status: done

submitted: 2018-08-07 14:19:39, status changed: 2018-08-07 14:27:19
Settings
Chain sequence(s) A: MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2479
Maximal score value
1.0715
Average score
-0.8
Total score value
-218.4088

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3636
2 S A -0.3572
3 G A -0.4523
4 D A -1.4285
5 K A -1.5127
6 L A 0.2422
7 L A -0.4311
8 S A -0.9546
9 E A -2.1937
10 L A -0.8057
11 G A -1.4240
12 Y A 0.0000
13 K A -1.5421
14 L A 0.0000
15 G A -0.9705
16 R A -1.6954
17 T A -1.1260
18 I A -0.2500
19 G A -1.2195
20 E A -2.2018
21 G A -1.4309
22 S A -0.6430
23 Y A -0.7545
24 S A -1.0537
25 K A -1.4445
26 V A -0.8675
27 K A -0.9757
28 V A -0.3235
29 A A 0.0000
30 T A -1.2443
31 S A 0.0000
32 K A -2.9463
33 K A -2.3517
34 Y A -0.8701
35 K A -2.1493
36 G A -1.2311
37 T A -0.5897
38 V A 0.0000
39 A A 0.0000
40 I A 0.0000
41 K A -0.2748
42 V A -0.3793
43 V A 0.0000
44 D A -1.7952
45 R A -2.4416
46 R A -3.3470
47 R A -2.9032
48 A A 0.0000
49 P A -1.7321
50 P A -2.1575
51 D A -2.6595
52 F A -1.7031
53 V A -2.0237
54 N A -2.6712
55 K A -2.8417
56 F A -1.2498
57 L A 0.0000
58 P A -1.1243
59 R A -1.3964
60 E A 0.0000
61 L A 0.0000
62 S A -1.0597
63 I A 0.0000
64 L A 0.0000
65 R A -2.2090
66 G A -1.9741
67 V A 0.0000
68 R A -2.4212
69 H A -1.3049
70 P A -1.0693
71 H A -1.0164
72 I A 0.0000
73 V A 0.0000
74 H A -0.8886
75 V A -0.1114
76 F A 1.0499
77 E A 0.2166
78 F A 0.4474
79 I A -0.1497
80 E A -1.3341
81 V A -0.4209
82 C A -0.1696
83 N A -1.6464
84 G A -1.5193
85 K A -1.6402
86 L A 0.0000
87 Y A -0.0620
88 I A 0.0000
89 V A 0.0000
90 M A 0.0000
91 E A -0.0855
92 A A -0.1029
93 A A -0.4046
94 A A -0.1842
95 T A -0.4040
96 D A -1.1632
97 L A 0.0000
98 L A -1.4472
99 Q A -2.4847
100 A A 0.0000
101 V A 0.0000
102 Q A -3.1770
103 R A -3.5911
104 N A -3.1746
105 G A -2.7216
106 R A -2.8820
107 I A 0.0000
108 P A -0.7462
109 G A -0.4209
110 V A 0.9817
111 Q A -0.5291
112 A A 0.0000
113 R A -0.6745
114 D A -1.6864
115 L A 0.0000
116 F A 0.0000
117 A A -0.9218
118 Q A -0.8105
119 I A 0.0000
120 A A 0.0000
121 G A -0.4857
122 A A 0.0000
123 V A 0.0000
124 R A -1.6111
125 Y A -1.5302
126 L A 0.0000
127 H A 0.0000
128 D A -2.7817
129 H A -2.5550
130 H A -2.5365
131 L A -1.6770
132 V A 0.0000
133 H A 0.0000
134 R A 0.0000
135 D A 0.0000
136 L A 0.0000
137 K A -0.4483
138 C A 0.0000
139 E A -1.1786
140 N A 0.0000
141 V A 0.0000
142 L A -0.7235
143 L A 0.0000
144 S A -2.3569
145 P A -2.7868
146 D A -3.5698
147 E A -4.1131
148 R A -4.2479
149 R A -3.5809
150 V A 0.0000
151 K A -0.8981
152 L A 0.0000
153 T A -0.7339
154 D A -1.0012
155 F A 0.0000
156 G A -0.3596
157 F A 0.0878
158 G A 0.0000
159 R A -1.0387
160 Q A -1.8247
161 A A -1.8589
162 H A -1.5243
163 G A -0.7528
164 Y A 0.2585
165 P A -0.7646
166 D A -1.8425
167 L A 0.0000
168 S A -0.4988
169 T A 0.1377
170 T A 0.2442
171 Y A 0.7967
172 C A 0.4773
173 G A 0.1143
174 S A -0.0494
175 A A 0.3531
176 A A 0.0000
177 Y A 0.0000
178 A A 0.0000
179 S A 0.0000
180 P A 0.0000
181 E A 0.0000
182 V A 0.0000
183 L A 0.3650
184 L A 0.7766
185 G A 0.4009
186 I A 0.9619
187 P A 0.0213
188 Y A 0.0000
189 D A -1.0489
190 P A 0.0000
191 K A -1.5351
192 K A -0.9874
193 Y A 0.0000
194 D A 0.0000
195 V A 0.0000
196 W A 0.0000
197 S A 0.0000
198 M A 0.0000
199 G A 0.0000
200 V A 0.0000
201 V A 0.0000
202 L A 0.0000
203 Y A 0.0000
204 V A 0.0000
205 M A 0.0000
206 V A 0.0000
207 T A 0.0000
208 G A -1.2700
209 C A -0.3650
210 M A -0.0058
211 P A 0.0000
212 F A 0.0000
213 D A -1.2084
214 D A -1.8388
215 S A -1.3805
216 D A -1.5496
217 I A 0.4963
218 A A -0.3087
219 G A -1.3733
220 L A 0.0000
221 P A -1.3367
222 R A -2.4452
223 R A -1.9562
224 Q A 0.0000
225 K A -1.8234
226 R A -2.3335
227 G A -0.8925
228 V A 0.2467
229 L A 0.8151
230 Y A 1.0715
231 P A 0.3747
232 E A -0.6983
233 G A -0.4278
234 L A 0.1378
235 E A -1.7634
236 L A 0.0000
237 S A -1.6007
238 E A -2.6703
239 R A -2.0236
240 C A 0.0000
241 K A -2.0323
242 A A -1.4582
243 L A 0.0000
244 I A 0.0000
245 A A -0.9103
246 E A -1.3374
247 L A 0.0000
248 L A 0.0000
249 Q A -0.4267
250 F A 0.2683
251 S A 0.1443
252 P A -0.4099
253 S A -0.3273
254 A A -0.3704
255 R A 0.0000
256 P A -1.2016
257 S A -1.1061
258 A A -1.3339
259 G A -1.3578
260 Q A -1.9067
261 V A 0.0000
262 A A -1.7485
263 R A -2.6721
264 N A -1.7473
265 C A -1.0315
266 W A 0.0000
267 L A 0.0000
268 R A -2.9725
269 A A -1.6127
270 G A -1.7335
271 D A -2.9166
272 S A -1.6573
273 G A -1.0659

 

Laboratory of Theory of Biopolymers 2015