Project name: 69eb740ac12f790

Status: done

submitted: 2018-12-11 11:46:36, status changed: 2018-12-11 11:53:45
Settings
Chain sequence(s) A: EKLVQPTPLLLSLLKSAGAQKETFTMKEVIYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEPRRLYAMISRNLVSANV
B: ETFSDLWKLLP
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4645
Maximal score value
1.3794
Average score
-1.0013
Total score value
-99.1316

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
21 E A -2.5922
22 K A -1.7713
23 L A -0.4562
24 V A 0.0000
25 Q A 0.0189
26 P A 0.0000
27 T A 0.0918
28 P A 0.0050
29 L A -0.0155
30 L A 0.0000
31 L A -1.0586
32 S A -0.8238
33 L A 0.0000
34 L A 0.0000
35 K A -2.7643
36 S A -1.3941
37 A A -1.1468
38 G A -1.6806
39 A A 0.0000
40 Q A -2.9551
41 K A -3.4645
42 E A -3.1345
43 T A -1.4393
44 F A 0.0000
45 T A -1.0566
46 M A -0.9440
47 K A -1.6732
48 E A -0.6904
49 V A 0.0000
50 I A 0.0000
51 Y A 0.3113
52 H A -0.2979
53 L A 0.0000
54 G A 0.0000
55 Q A -0.4706
56 Y A 0.0000
57 I A 0.0000
58 M A -0.6733
59 A A -0.9836
60 K A -1.8409
61 Q A -2.0178
62 L A -1.4353
63 Y A -1.5629
64 D A -2.4745
65 E A -3.2677
66 K A -3.4621
67 Q A -2.8791
68 Q A -2.5729
69 H A -1.9688
70 I A -1.3794
71 V A 0.0000
72 H A -1.5733
73 C A 0.0000
74 S A -2.0246
75 N A -1.9376
76 D A 0.0000
77 P A -1.0660
78 L A 0.0000
79 G A -1.9831
80 E A -2.2749
81 L A 0.0000
82 F A 0.0000
83 G A -1.3635
84 V A -1.2012
85 Q A -2.3303
86 E A -1.8603
87 F A 0.0000
88 S A -1.3945
89 V A 0.0000
90 K A -2.1172
91 E A -2.1093
92 P A -1.7839
93 R A -2.8483
94 R A -2.7039
95 L A 0.0000
96 Y A -1.0667
97 A A -1.3712
98 M A 0.0000
99 I A 0.0000
100 S A -0.8710
101 R A -1.6094
102 N A -0.5213
103 L A 0.0894
104 V A 1.3794
105 S A 0.6677
106 A A -0.1357
107 N A -0.5843
108 V A 1.2500
17 E B -2.5895
18 T B -2.1107
19 F B 0.0000
20 S B -1.3380
21 D B -2.0051
22 L B 0.0000
23 W B 0.0000
24 K B -1.1601
25 L B 0.2466
26 L B -0.4541
27 P B -0.4549

 

Laboratory of Theory of Biopolymers 2015