Project name: some project name

Status: done

submitted: 2017-11-14 15:38:14, status changed: 2017-11-14 15:43:34
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues IA1W, DA2W
Energy difference between WT (input) and mutated protein (by FoldX) 0.5077 kcal/mol
Show buried residues

Minimal score value
-2.3727
Maximal score value
1.353
Average score
-0.4168
Total score value
-41.2635

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 W A 1.3530 mutated: IA1W
2 W A 1.1692 mutated: DA2W
3 V A 0.0000
4 L A 0.2807
5 L A 0.0000
6 G A 0.0000
7 A A -0.3302
8 D A -2.1166
9 D A -2.1879
10 G A -0.7307
11 S A -0.0972
12 L A 0.4778
13 A A 0.1072
14 F A 0.0000
15 V A 0.6116
16 P A 0.0993
17 S A -0.3979
18 E A -1.8716
19 F A -0.1389
20 S A -0.1194
21 I A 0.0000
22 S A -0.1886
23 P A -0.2019
24 G A -0.3850
25 E A -0.9209
26 K A -1.4640
27 I A 0.0000
28 V A 0.2351
29 F A 0.0000
30 K A -0.7812
31 N A 0.0000
32 N A -0.1396
33 A A -0.0842
34 G A -0.2399
35 F A 0.5926
36 P A -0.0650
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -1.0255
43 E A -2.2783
44 D A -2.1428
45 S A -0.3818
46 I A 0.2068
47 P A -0.0255
48 S A -0.3046
49 G A -0.4429
50 V A 0.0372
51 D A -1.1469
52 A A -0.2561
53 S A -0.5225
54 K A -1.7389
55 I A 0.0000
56 S A -0.0122
57 M A 0.0926
58 S A -0.3909
59 E A -2.1698
60 E A -2.3727
61 D A -1.3553
62 L A 0.6852
63 L A 0.0000
64 N A -1.2760
65 A A -0.5023
66 K A -1.7777
67 G A -0.9240
68 E A -0.8818
69 T A -0.2430
70 F A -0.0346
71 E A -1.7114
72 V A 0.0000
73 A A -0.1552
74 L A 0.0000
75 S A -0.4575
76 N A -1.6266
77 K A -1.9567
78 G A -0.7200
79 E A -1.6143
80 Y A 0.0000
81 S A -0.1488
82 F A 0.0000
83 Y A 0.2993
84 C A 0.0000
85 S A -0.0982
86 P A -0.2523
87 H A -0.3235
88 Q A -0.8887
89 G A -0.5975
90 A A -0.1129
91 G A -0.4556
92 M A 0.0000
93 V A 0.8179
94 G A 0.0000
95 K A -1.0207
96 V A 0.0000
97 T A -0.2493
98 V A 0.0000
99 N A -1.2730

 

Laboratory of Theory of Biopolymers 2015