Project name: 6f4ba38ae0990d7

Status: done

submitted: 2017-12-06 11:48:05, status changed: 2017-12-06 13:08:59
Settings
Chain sequence(s) A: MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVASIRSGGGRTYYSDNVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAIIGLMVGGVVIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVICFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
C: MDMRVPAQLLGLLMLWVSGSSGDVVMTQSPLSLPVTPGEPASISCKSSQSLLDSDGKTYLNWLLQKPGQSPQRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVASIRSGGGRTYYSDNVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAIIGLMVGGVVIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVICFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
D: MDMRVPAQLLGLLMLWVSGSSGDVVMTQSPLSLPVTPGEPASISCKSSQSLLDSDGKTYLNWLLQKPGQSPQRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.5849
Maximal score value
4.1943
Average score
-0.6382
Total score value
-906.2819

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.5333
2 E A -0.1416
3 F A 1.4100
4 G A 1.0094
5 L A 1.8428
6 S A 1.5420
7 W A 2.3554
8 L A 2.9541
9 F A 3.7945
10 L A 4.1943
11 V A 3.8873
12 A A 3.0925
13 I A 3.1961
14 L A 2.2598
15 K A -0.2209
16 G A 0.2783
17 V A 1.6835
18 Q A 1.3125
19 C A 1.0728
20 E A 0.1786
21 V A 0.2958
22 Q A 0.4367
23 L A 0.0000
24 L A 0.7738
25 E A -0.0959
26 S A -0.5358
27 G A -0.5905
28 G A -0.2327
29 G A -0.0694
30 L A 0.4788
31 V A -0.2761
32 Q A -1.2086
33 P A -1.7644
34 G A -1.4422
35 G A -0.9416
36 S A -1.2006
37 L A -0.8950
38 R A -1.9346
39 L A 0.0000
40 S A -0.4333
41 C A 0.0000
42 A A -0.3018
43 A A 0.0000
44 S A -0.3746
45 G A -0.2653
46 F A -0.0381
47 T A -0.4493
48 F A 0.0000
49 S A -1.5888
50 N A -1.2094
51 Y A -0.1269
52 G A -1.0051
53 M A 0.0000
54 S A 0.0000
55 W A 0.0000
56 V A 0.0000
57 R A -0.6223
58 Q A -1.0133
59 A A 0.0000
60 P A -1.3372
61 G A -1.6397
62 K A -2.5386
63 G A -1.8706
64 L A 0.0000
65 E A -1.4069
66 W A 0.0000
67 V A 0.0000
68 A A 0.0000
69 S A -0.3794
70 I A 0.0000
71 R A -2.8439
72 S A -2.4721
73 G A -2.1388
74 G A -2.0666
75 G A -2.4673
76 R A -2.6923
77 T A -1.2550
78 Y A -0.0412
79 Y A -0.5698
80 S A 0.0000
81 D A -2.6782
82 N A -2.6783
83 V A 0.0000
84 K A -2.6544
85 G A -2.0668
86 R A -1.8646
87 F A 0.0000
88 T A -0.9233
89 I A 0.0000
90 S A -1.2137
91 R A -2.0811
92 D A -2.3398
93 N A -2.8033
94 S A -2.1458
95 K A -2.8072
96 N A -2.3308
97 T A 0.0000
98 L A 0.0000
99 Y A -0.6281
100 L A 0.0000
101 Q A -1.2787
102 M A 0.0000
103 N A -1.4052
104 S A -1.2623
105 L A 0.0000
106 R A -2.8341
107 A A -1.9953
108 E A -2.4276
109 D A 0.0000
110 T A -0.6412
111 A A 0.0000
112 V A 0.4704
113 Y A 0.0000
114 Y A 0.0000
115 C A 0.0000
116 A A 0.1500
117 I A 0.0000
118 I A -0.0439
119 G A 0.0000
120 L A 0.0000
121 M A 0.0000
122 V A 0.0000
123 G A 0.0000
124 G A -0.0368
125 V A 0.2488
126 V A 0.7765
127 I A 0.2355
128 W A 0.0000
129 G A 0.0000
130 Q A -0.8798
131 G A 0.0000
132 T A 0.0000
133 L A 0.9161
134 V A 0.0000
135 T A -0.1482
136 V A 0.0000
137 S A -0.9608
138 S A -0.7516
139 A A -0.5271
140 S A -0.5650
141 T A -0.7845
142 K A -1.4235
143 G A -1.4445
144 P A -0.6942
145 S A -0.1933
146 V A 0.0000
147 F A -0.4863
148 P A -1.0185
149 L A 0.0000
150 A A 0.0000
151 P A 0.0000
152 S A -0.8669
153 S A -0.6522
154 K A -1.0602
155 S A -0.9326
156 T A -0.9064
157 S A -0.8014
158 G A -0.8672
159 G A -0.9162
160 T A -0.6972
161 A A 0.0000
162 A A 0.0000
163 L A 0.0000
164 G A 0.0000
165 C A 0.0000
166 L A 0.0000
167 V A 0.0000
168 K A 0.0000
169 D A -0.5173
170 Y A 0.0000
171 F A 0.0000
172 P A -0.6718
173 E A -0.9089
174 P A -0.8843
175 V A -0.7417
176 T A -0.6192
177 V A -0.2800
178 S A -0.5014
179 W A 0.0000
180 N A -0.8571
181 S A -0.7728
182 G A -0.6336
183 A A -0.3033
184 L A -0.0483
185 T A -0.2072
186 S A -0.1826
187 G A -0.2105
188 V A 0.1828
189 H A -0.0990
190 T A 0.0155
191 F A 0.0000
192 P A -0.3728
193 A A 0.0370
194 V A 0.2480
195 L A 0.6389
196 Q A 0.0565
197 S A -0.1620
198 S A -0.2712
199 G A -0.0945
200 L A -0.0704
201 Y A 0.2951
202 S A 0.1093
203 L A 0.0000
204 S A 0.0000
205 S A 0.0000
206 V A 0.0000
207 V A 0.0000
208 T A -0.1529
209 V A 0.0000
210 P A -0.5546
211 S A -0.5829
212 S A -0.5687
213 S A -0.7081
214 L A -0.8769
215 G A -1.0633
216 T A -0.8905
217 Q A -1.5397
218 T A -1.2083
219 Y A 0.0000
220 I A -1.3218
221 C A 0.0000
222 N A -1.6919
223 V A 0.0000
224 N A -1.9206
225 H A 0.0000
226 K A -2.6725
227 P A -1.6436
228 S A -1.9348
229 N A -2.4564
230 T A -2.1017
231 K A -2.6864
232 V A -1.6005
233 D A -2.6124
234 K A -2.0409
235 K A -2.2414
236 V A 0.0000
237 E A -2.6954
238 P A -1.6577
239 K A -1.8107
240 S A -1.4623
241 C A -1.2106
242 D A -2.8632
243 K A -3.2189
244 T A -2.2607
245 H A -2.5519
246 T A -1.7942
247 C A -0.6404
248 P A -0.6698
249 P A -0.0458
250 C A 0.4212
251 P A -0.2527
252 A A -1.1159
253 P A -1.5986
254 E A -2.1193
255 A A -0.5607
256 L A 0.5018
257 G A -0.0173
258 A A -0.4916
259 P A 0.0000
260 S A 0.1804
261 V A 0.0000
262 F A 1.4615
263 L A 1.1939
264 F A 1.4864
265 P A 0.0012
266 P A 0.0000
267 K A -2.0785
268 P A -1.2604
269 K A -0.9591
270 D A 0.0000
271 T A 0.0000
272 L A -0.2362
273 M A 0.3895
274 I A 1.3501
275 S A -0.0862
276 R A -1.5374
277 T A -0.7173
278 P A 0.0000
279 E A -0.9106
280 V A 0.0000
281 T A 0.6010
282 C A 0.0000
283 V A 0.0000
284 V A 0.0000
285 V A -1.0601
286 D A -1.7880
287 V A 0.0000
288 S A -2.3626
289 H A -2.7286
290 E A -3.2314
291 D A -2.7687
292 P A -2.5900
293 E A -2.3331
294 V A -0.4697
295 I A 1.4233
296 C A 1.1987
297 F A 0.5897
298 N A -0.3799
299 W A 0.0000
300 Y A -1.0224
301 V A -0.8977
302 D A -1.6778
303 G A -0.6690
304 V A 0.5449
305 E A -1.3313
306 V A -0.8974
307 H A -2.0459
308 N A -2.2058
309 A A -1.7333
310 K A -2.4372
311 T A -1.5784
312 K A -2.6891
313 P A -2.6436
314 R A -4.3221
315 E A -4.5849
316 E A -4.0006
317 Q A -2.7619
318 Y A -0.2401
319 N A -1.3865
320 S A -1.5043
321 T A -2.2783
322 Y A 0.0000
323 R A -3.7838
324 V A 0.0000
325 V A 0.0000
326 S A 0.0000
327 V A -0.7043
328 L A 0.0000
329 T A -0.5603
330 V A 0.0000
331 L A 0.1648
332 H A -0.5016
333 Q A -1.5807
334 D A -1.6860
335 W A 0.0000
336 L A -1.2205
337 N A -2.2815
338 G A -2.2348
339 K A -2.3372
340 E A -2.6558
341 Y A 0.0000
342 K A -1.4300
343 C A 0.0000
344 K A -0.5056
345 V A 0.0000
346 S A -0.0149
347 N A 0.0000
348 K A -2.1849
349 A A -1.7481
350 L A 0.0000
351 P A -0.5944
352 A A -0.3447
353 P A -0.2283
354 I A 0.0864
355 E A -0.9316
356 K A -0.7612
357 T A -0.8816
358 I A -0.4418
359 S A -1.3469
360 K A -1.4694
361 A A -1.0573
362 K A -2.2667
363 G A -1.7959
364 Q A -1.8651
365 P A -1.8160
366 R A -1.9784
367 E A -2.4726
368 P A 0.0000
369 Q A -1.3960
370 V A 0.0000
371 Y A 0.0000
372 T A 0.0000
373 L A 0.0000
374 P A -0.4485
375 P A -0.9894
376 S A -1.5884
377 R A -2.8845
378 E A -2.9671
379 E A 0.0000
380 M A -2.1353
381 T A -1.9787
382 K A -3.0354
383 N A -3.0136
384 Q A -2.9579
385 V A 0.0000
386 S A 0.0000
387 L A 0.0000
388 T A 0.0000
389 C A 0.0000
390 L A 0.0000
391 V A 0.0000
392 K A -0.5068
393 G A -0.9924
394 F A 0.0000
395 Y A -0.9401
396 P A 0.0000
397 S A -0.3623
398 D A -0.9352
399 I A -0.4834
400 A A -0.3834
401 V A -0.2545
402 E A -0.9820
403 W A 0.0000
404 E A -1.7659
405 S A 0.0000
406 N A -1.8508
407 G A -1.9011
408 Q A -2.3506
409 P A -2.0292
410 E A -1.9974
411 N A -2.3672
412 N A -2.0954
413 Y A -1.3172
414 K A -1.2439
415 T A -0.4208
416 T A 0.0000
417 P A -0.2182
418 P A 0.0285
419 V A 0.0000
420 L A 0.5087
421 D A -0.5800
422 S A -1.1345
423 D A -1.8312
424 G A -0.8390
425 S A 0.0000
426 F A 0.1039
427 F A 0.0000
428 L A 0.0000
429 Y A 0.0000
430 S A 0.0000
431 K A 0.0000
432 L A 0.0000
433 T A -1.2701
434 V A 0.0000
435 D A -3.0446
436 K A -2.8993
437 S A -2.2117
438 R A -2.0087
439 W A 0.0000
440 Q A -2.0643
441 Q A -2.1572
442 G A -1.3188
443 N A -0.6119
444 V A 0.5858
445 F A 0.0000
446 S A -0.7605
447 C A 0.0000
448 S A 0.0000
449 V A 0.0000
450 M A 0.0000
451 H A 0.0000
452 E A -1.2114
453 A A -1.5984
454 L A -1.5284
455 H A -1.8497
456 N A -1.7439
457 H A -1.2478
458 Y A -0.5955
459 T A -0.8997
460 Q A -1.4590
461 K A -1.2957
462 S A -0.4539
463 L A 0.0000
464 S A 0.0362
465 L A -0.4966
466 S A -0.6840
467 P A -0.9722
468 G A -1.6287
469 K A -2.3975
470 M B 0.8172
471 E B -0.2518
472 F B 1.3759
473 G B 0.9972
474 L B 1.8902
475 S B 1.6667
476 W B 2.5300
477 L B 3.4198
478 F B 3.8758
479 L B 4.0382
480 V B 3.8817
481 A B 2.7627
482 I B 2.8764
483 L B 1.9921
484 K B -0.3529
485 G B 0.0525
486 V B 0.8486
487 Q B -0.4920
488 C B -0.4018
489 E B -1.6653
490 V B -0.6924
491 Q B -0.9456
492 L B 0.0000
493 L B 1.0539
494 E B 0.1317
495 S B -0.5043
496 G B -0.5699
497 G B -0.5413
498 G B -0.1204
499 L B 0.8744
500 V B 0.0283
501 Q B -1.0767
502 P B -1.6722
503 G B -1.3714
504 G B -0.9116
505 S B -1.0790
506 L B -0.9534
507 R B -2.0251
508 L B 0.0000
509 S B -0.4395
510 C B 0.0000
511 A B -0.3480
512 A B 0.0000
513 S B -0.6516
514 G B -0.9908
515 F B -0.2402
516 T B -0.1199
517 F B 0.0000
518 S B -0.5655
519 N B 0.4092
520 Y B 0.2808
521 G B -0.3764
522 M B 0.0000
523 S B 0.0000
524 W B 0.0000
525 V B 0.0000
526 R B 0.0000
527 Q B -1.1390
528 A B 0.0000
529 P B -1.3182
530 G B -1.6307
531 K B -2.5490
532 G B -1.9059
533 L B 0.0000
534 E B -1.6412
535 W B -0.5096
536 V B 0.0000
537 A B 0.0000
538 S B -0.2177
539 I B 0.0000
540 R B -1.1722
541 S B 0.0000
542 G B -0.6558
543 G B -1.3908
544 G B -1.9239
545 R B -2.2701
546 T B -0.9918
547 Y B -0.2675
548 Y B -0.4770
549 S B -1.4775
550 D B -2.5716
551 N B -2.4621
552 V B 0.0000
553 K B -1.6101
554 G B 0.0000
555 R B -0.2555
556 F B 0.0000
557 T B -0.5008
558 I B 0.0000
559 S B -0.8401
560 R B -1.3524
561 D B -2.0173
562 N B -2.4027
563 S B -1.9751
564 K B -2.7156
565 N B -2.1941
566 T B 0.0000
567 L B 0.0000
568 Y B -0.6356
569 L B 0.0000
570 Q B -1.3853
571 M B 0.0000
572 N B -0.9607
573 S B -1.0546
574 L B 0.0000
575 R B -2.7455
576 A B -2.0440
577 E B -2.5052
578 D B -1.6950
579 T B -0.9443
580 A B 0.0000
581 V B -0.0140
582 Y B 0.0000
583 Y B 0.0000
584 C B 0.0000
585 A B 0.0000
586 I B 0.3408
587 I B 0.0000
588 G B 0.0000
589 L B 0.5797
590 M B 1.3669
591 V B 1.9872
592 G B 1.2637
593 G B 1.6536
594 V B 3.0832
595 V B 2.9134
596 I B 2.3902
597 W B 0.8397
598 G B -0.4155
599 Q B -0.6578
600 G B -0.4167
601 T B 0.0000
602 L B 0.0000
603 V B 0.1241
604 T B -0.0153
605 V B -0.0179
606 S B 0.0000
607 S B -0.2916
608 A B -0.2043
609 S B 0.0000
610 T B -0.1751
611 K B 0.0000
612 G B -0.8200
613 P B -0.4004
614 S B -0.1867
615 V B 1.0567
616 F B 2.1020
617 P B 0.9708
618 L B 0.8820
619 A B -0.4832
620 P B 0.0000
621 S B -0.2949
622 S B -1.1178
623 K B -1.4368
624 S B -1.4867
625 T B 0.0000
626 S B -1.3683
627 G B -1.0647
628 G B -0.6452
629 T B -0.4062
630 A B -0.2871
631 A B 0.0000
632 L B 0.0000
633 G B 0.0000
634 C B 0.0000
635 L B 0.0000
636 V B 0.0000
637 K B -0.4322
638 D B -0.2800
639 Y B 0.0000
640 F B 0.0000
641 P B 0.0000
642 E B -1.7046
643 P B -1.3597
644 V B -1.0029
645 T B -0.7932
646 V B -0.3738
647 S B -0.4334
648 W B 0.0000
649 N B -0.7521
650 S B -0.6738
651 G B -0.5728
652 A B -0.2508
653 L B 0.0132
654 T B -0.1796
655 S B -0.1990
656 G B -0.2878
657 V B 0.1045
658 H B -0.2304
659 T B -0.0405
660 F B 0.0000
661 P B -0.4662
662 A B 0.0053
663 V B 0.3692
664 L B 1.2414
665 Q B 0.1923
666 S B -0.0324
667 S B -0.1645
668 G B 0.3605
669 L B 0.0000
670 Y B 0.2398
671 S B -0.0489
672 L B 0.0000
673 S B 0.0000
674 S B 0.0000
675 V B 0.0000
676 V B 0.0000
677 T B -0.2207
678 V B 0.0000
679 P B -0.4280
680 S B -0.6668
681 S B -0.7910
682 S B -0.8218
683 L B -1.3522
684 G B -1.7206
685 T B -0.9475
686 Q B -1.4281
687 T B -1.2883
688 Y B 0.0000
689 I B -1.4673
690 C B 0.0000
691 N B -1.4495
692 V B 0.0000
693 N B -1.9633
694 H B 0.0000
695 K B -2.7793
696 P B -1.5434
697 S B -1.3540
698 N B -2.1747
699 T B -1.8912
700 K B -2.5145
701 V B -1.1801
702 D B -2.4568
703 K B -2.4186
704 K B -2.7740
705 V B 0.0000
706 E B -2.9069
707 P B -2.3178
708 K B -2.3208
709 S B -1.5188
710 C B -0.9006
711 D B -2.0372
712 K B -2.8357
713 T B -1.7287
714 H B -1.6786
715 T B -0.8460
716 C B -0.1060
717 P B -0.1835
718 P B 0.0232
719 C B 0.2774
720 P B -0.4884
721 A B -0.7309
722 P B -1.0384
723 E B -1.8874
724 A B -0.4635
725 L B 0.2799
726 G B -0.2919
727 A B -0.4447
728 P B 0.0000
729 S B -0.2519
730 V B 0.0000
731 F B 0.9748
732 L B 0.0000
733 F B 1.2813
734 P B 0.0704
735 P B 0.0000
736 K B -1.8686
737 P B -1.4230
738 K B -1.5107
739 D B -1.4041
740 T B 0.0000
741 L B -0.4964
742 M B 0.4182
743 I B 1.3768
744 S B -0.0401
745 R B -1.6600
746 T B -0.8535
747 P B 0.0000
748 E B -0.8098
749 V B 0.0000
750 T B 0.2967
751 C B 0.0000
752 V B 0.0000
753 V B 0.0000
754 V B -1.0428
755 D B -2.3052
756 V B 0.0000
757 S B -1.3006
758 H B -1.4410
759 E B -1.1279
760 D B -1.4254
761 P B -1.6464
762 E B -1.7682
763 V B -0.0002
764 I B 1.7329
765 C B 0.0000
766 F B 1.0001
767 N B -0.2320
768 W B 0.0000
769 Y B -0.7859
770 V B -0.9964
771 D B -2.0772
772 G B -0.9577
773 V B 0.3823
774 E B -1.4280
775 V B -0.8886
776 H B -1.9607
777 N B -2.2533
778 A B -1.6167
779 K B -2.3431
780 T B -1.3256
781 K B -2.5538
782 P B -2.5414
783 R B -3.7336
784 E B -3.9244
785 E B -3.6687
786 Q B -2.2818
787 Y B -0.2569
788 N B -1.3585
789 S B -1.2643
790 T B -2.1280
791 Y B -2.8736
792 R B -2.9864
793 V B 0.0000
794 V B -0.9556
795 S B 0.0000
796 V B 0.0000
797 L B 0.0000
798 T B -0.6037
799 V B 0.0000
800 L B 0.2392
801 H B -0.3485
802 Q B -1.4515
803 D B -1.5220
804 W B 0.0000
805 L B -0.9814
806 N B -1.9910
807 G B -2.1936
808 K B -2.3336
809 E B -2.3006
810 Y B 0.0000
811 K B -1.7467
812 C B 0.0000
813 K B -0.7067
814 V B 0.0000
815 S B 0.1669
816 N B -0.3773
817 K B -1.5485
818 A B 0.0000
819 L B 0.0000
820 P B -0.5253
821 A B -0.5318
822 P B -0.3389
823 I B -0.6886
824 E B -1.9519
825 K B -1.3656
826 T B -1.0732
827 I B -0.2551
828 S B -1.0843
829 K B -1.3621
830 A B -1.2421
831 K B -2.2701
832 G B -2.1113
833 Q B -2.4185
834 P B -2.3257
835 R B -2.9945
836 E B -3.1370
837 P B 0.0000
838 Q B -1.3243
839 V B 0.0000
840 Y B 0.0000
841 T B 0.0000
842 L B 0.0000
843 P B -0.3713
844 P B 0.0000
845 S B -1.5688
846 R B -2.7345
847 E B -2.8536
848 E B 0.0000
849 M B -1.8645
850 T B -1.4931
851 K B -1.7624
852 N B -2.2915
853 Q B -2.1853
854 V B 0.0000
855 S B 0.0000
856 L B 0.0000
857 T B 0.0000
858 C B 0.0000
859 L B 0.0000
860 V B 0.0000
861 K B -0.6039
862 G B -1.2113
863 F B 0.0000
864 Y B -1.4945
865 P B 0.0000
866 S B -0.4435
867 D B -1.2781
868 I B 0.0000
869 A B 0.0000
870 V B 0.0000
871 E B -1.0403
872 W B 0.0000
873 E B -1.7519
874 S B 0.0000
875 N B -1.8970
876 G B -1.8927
877 Q B -2.3357
878 P B -1.9191
879 E B -1.8084
880 N B -1.9530
881 N B -1.2622
882 Y B -0.8598
883 K B -0.9665
884 T B -0.4183
885 T B 0.0000
886 P B -0.3132
887 P B -0.0899
888 V B 0.0000
889 L B 0.4886
890 D B -0.7806
891 S B -1.3533
892 D B -1.9148
893 G B -0.9296
894 S B 0.0000
895 F B -0.0917
896 F B 0.0000
897 L B 0.0000
898 Y B 0.0000
899 S B 0.0000
900 K B 0.0000
901 L B 0.0000
902 T B 0.0000
903 V B 0.0000
904 D B -2.2605
905 K B -2.5137
906 S B -2.2094
907 R B -1.9514
908 W B 0.0000
909 Q B -2.3192
910 Q B -2.1089
911 G B -1.0922
912 N B -0.7155
913 V B 0.4489
914 F B 0.0000
915 S B -0.8907
916 C B 0.0000
917 S B 0.0000
918 V B 0.0000
919 M B 0.0000
920 H B 0.0000
921 E B -1.3879
922 A B -1.9893
923 L B 0.0000
924 H B -1.9630
925 N B -1.8105
926 H B -1.3917
927 Y B -0.4862
928 T B -0.9431
929 Q B -1.5645
930 K B -1.4496
931 S B -0.6406
932 L B 0.0000
933 S B -0.0124
934 L B -0.1398
935 S B -0.5787
936 P B -0.8668
937 G B -1.4148
938 K B -2.0154
939 M C -0.3845
940 D C -0.7817
941 M C 0.0000
942 R C 0.0000
943 V C 0.0000
944 P C -1.0036
945 A C -0.7370
946 Q C -0.4651
947 L C 1.1614
948 L C 2.2274
949 G C 2.0734
950 L C 3.2737
951 L C 3.2047
952 M C 3.0880
953 L C 3.3103
954 W C 2.9699
955 V C 2.4257
956 S C 0.5657
957 G C -0.4039
958 S C -1.1467
959 S C -1.4722
960 G C -1.2907
961 D C -1.3815
962 V C 0.0000
963 V C 0.5889
964 M C 0.0000
965 T C 0.0207
966 Q C 0.0000
967 S C -0.0269
968 P C 0.3570
969 L C 0.9636
970 S C -0.0611
971 L C 0.0251
972 P C -0.6271
973 V C -0.7509
974 T C -1.4162
975 P C -1.7344
976 G C -2.0346
977 E C -2.5316
978 P C -2.2153
979 A C 0.0000
980 S C -1.0112
981 I C 0.0000
982 S C -0.7092
983 C C 0.0000
984 K C -1.1421
985 S C 0.0000
986 S C -0.4268
987 Q C -0.4665
988 S C 0.0000
989 L C 0.0000
990 L C 1.0229
991 D C 0.3306
992 S C 0.2092
993 D C 0.4072
994 G C 0.0000
995 K C 0.0000
996 T C 0.4043
997 Y C 0.8712
998 L C 0.0000
999 N C 0.0000
1000 W C 0.0000
1001 L C 0.0000
1002 L C 0.0000
1003 Q C -1.0168
1004 K C -1.2209
1005 P C -1.2172
1006 G C -1.4047
1007 Q C -1.8805
1008 S C 0.0000
1009 P C 0.0000
1010 Q C -1.1501
1011 R C -0.7531
1012 L C 0.0000
1013 I C 0.0000
1014 Y C 0.3682
1015 L C 0.8449
1016 V C 0.0000
1017 S C -0.5522
1018 K C -1.0357
1019 L C -0.8960
1020 D C -0.8207
1021 S C -0.6377
1022 G C -0.4360
1023 V C -0.9582
1024 P C -1.2145
1025 D C -2.0501
1026 R C -2.1836
1027 F C 0.0000
1028 S C -1.3701
1029 G C 0.0000
1030 S C -0.9524
1031 G C -1.1217
1032 S C -0.8414
1033 G C -0.5318
1034 T C -1.2858
1035 D C -2.0405
1036 F C 0.0000
1037 T C -1.0668
1038 L C 0.0000
1039 K C -1.8755
1040 I C 0.0000
1041 S C -2.4202
1042 R C -3.1923
1043 V C 0.0000
1044 E C -2.5342
1045 A C -1.5343
1046 E C -2.1230
1047 D C 0.0000
1048 V C -0.6158
1049 G C 0.0000
1050 V C -0.5578
1051 Y C 0.0000
1052 Y C 0.0000
1053 C C 0.0000
1054 W C 0.0000
1055 Q C 0.0000
1056 G C 0.0000
1057 T C -0.4500
1058 H C -0.1912
1059 F C -0.0355
1060 P C -0.7375
1061 R C -0.8484
1062 T C -0.4184
1063 F C -0.2913
1064 G C 0.0000
1065 Q C -0.9411
1066 G C -0.4856
1067 T C 0.0000
1068 K C -0.9912
1069 V C 0.0000
1070 E C -0.9750
1071 I C -0.7150
1072 K C -1.3220
1073 R C -1.4716
1074 T C -0.1642
1075 V C 1.0239
1076 A C 0.2202
1077 A C 0.0489
1078 P C 0.0000
1079 S C -0.2316
1080 V C 0.0000
1081 F C 0.0000
1082 I C -0.0905
1083 F C 0.0000
1084 P C -0.4810
1085 P C 0.0000
1086 S C 0.0000
1087 D C -2.8421
1088 E C -2.6120
1089 Q C 0.0000
1090 L C -1.9441
1091 K C -2.6639
1092 S C -1.7309
1093 G C -1.1280
1094 T C -0.7638
1095 A C 0.0000
1096 S C 0.0000
1097 V C 0.0000
1098 V C 0.0000
1099 C C 0.0000
1100 L C 0.0000
1101 L C 0.0000
1102 N C -0.3491
1103 N C -0.7342
1104 F C 0.0000
1105 Y C 0.0000
1106 P C -1.5750
1107 R C -3.0080
1108 E C -3.1594
1109 A C -2.3198
1110 K C -2.4327
1111 V C -1.0881
1112 Q C -0.5689
1113 W C 0.0000
1114 K C -0.5786
1115 V C 0.0000
1116 D C -1.9325
1117 N C -1.5298
1118 A C -0.3404
1119 L C 0.6763
1120 Q C -0.3724
1121 S C -0.7292
1122 G C -1.2743
1123 N C -1.5760
1124 S C -1.4622
1125 Q C -1.5736
1126 E C -1.8998
1127 S C -0.7965
1128 V C -0.6881
1129 T C -1.1013
1130 E C -2.2004
1131 Q C -1.7932
1132 D C -1.8176
1133 S C -1.6477
1134 K C -2.1315
1135 D C -1.5984
1136 S C 0.0000
1137 T C 0.0000
1138 Y C 0.0000
1139 S C 0.0000
1140 L C 0.0000
1141 S C 0.0000
1142 S C 0.0000
1143 T C -0.7670
1144 L C 0.0000
1145 T C -0.5066
1146 L C -0.6122
1147 S C -1.0218
1148 K C -1.8366
1149 A C -1.6321
1150 D C -1.9223
1151 Y C 0.0000
1152 E C -3.4777
1153 K C -3.4062
1154 H C -2.8310
1155 K C -2.7234
1156 V C -1.2023
1157 Y C 0.0000
1158 A C 0.0000
1159 C C 0.0000
1160 E C -0.7092
1161 V C 0.0000
1162 T C -1.1997
1163 H C 0.0000
1164 Q C -1.6706
1165 G C -0.3315
1166 L C -0.2340
1167 S C -0.4888
1168 S C -0.4539
1169 P C -0.6181
1170 V C -0.0071
1171 T C -0.4280
1172 K C -0.7222
1173 S C -0.3520
1174 F C -0.7866
1175 N C -1.6741
1176 R C -2.6319
1177 G C -2.3958
1178 E C -2.4056
1179 C C -1.0411
1180 M D 0.2367
1181 D D -0.9848
1182 M D -0.0326
1183 R D -0.8598
1184 V D 0.6304
1185 P D 0.2665
1186 A D 0.1507
1187 Q D 0.0514
1188 L D 1.7571
1189 L D 2.3107
1190 G D 1.6963
1191 L D 2.6516
1192 L D 2.8941
1193 M D 2.1446
1194 L D 2.9459
1195 W D 2.6313
1196 V D 1.8568
1197 S D 0.2706
1198 G D -0.9665
1199 S D -1.4803
1200 S D -1.5894
1201 G D -1.0960
1202 D D -1.9321
1203 V D 0.0000
1204 V D 0.4241
1205 M D 0.0000
1206 T D -0.4362
1207 Q D 0.0000
1208 S D -0.1580
1209 P D 0.4531
1210 L D 1.1679
1211 S D 0.5054
1212 L D 0.2466
1213 P D -0.4428
1214 V D -0.6080
1215 T D -1.3291
1216 P D -1.9265
1217 G D -2.1943
1218 E D -2.7402
1219 P D -2.1459
1220 A D 0.0000
1221 S D -0.7876
1222 I D 0.0000
1223 S D -0.7520
1224 C D 0.0000
1225 K D -1.7660
1226 S D 0.0000
1227 S D -0.9612
1228 Q D -1.2204
1229 S D -0.9470
1230 L D 0.0000
1231 L D 0.3804
1232 D D -1.1006
1233 S D -0.3919
1234 D D 0.0000
1235 G D 0.0000
1236 K D 0.0000
1237 T D 0.0000
1238 Y D 0.0000
1239 L D 0.0000
1240 N D 0.0000
1241 W D 0.0000
1242 L D 0.0000
1243 L D 0.0000
1244 Q D -0.9978
1245 K D -1.4987
1246 P D -1.3431
1247 G D -1.3198
1248 Q D -1.7927
1249 S D -1.1882
1250 P D 0.0000
1251 Q D -1.3299
1252 R D -0.6388
1253 L D 0.0000
1254 I D 0.0000
1255 Y D -0.1845
1256 L D -0.2784
1257 V D -0.2726
1258 S D -0.6855
1259 K D -1.2511
1260 L D -0.7673
1261 D D -0.5859
1262 S D -0.5493
1263 G D -0.8196
1264 V D -0.7273
1265 P D -1.1345
1266 D D -2.1797
1267 R D -2.1100
1268 F D 0.0000
1269 S D -1.3105
1270 G D 0.0000
1271 S D -0.8059
1272 G D -0.8332
1273 S D -0.6284
1274 G D -0.8157
1275 T D -1.1897
1276 D D -1.7350
1277 F D 0.0000
1278 T D -0.9556
1279 L D 0.0000
1280 K D -1.8475
1281 I D 0.0000
1282 S D -2.4484
1283 R D -3.4115
1284 V D 0.0000
1285 E D -2.3983
1286 A D -1.3254
1287 E D -2.1169
1288 D D 0.0000
1289 V D -0.4593
1290 G D 0.0000
1291 V D -0.0350
1292 Y D 0.0000
1293 Y D 0.0000
1294 C D 0.0000
1295 W D 0.0000
1296 Q D 0.0000
1297 G D 0.0000
1298 T D -0.4988
1299 H D -0.2307
1300 F D 0.5590
1301 P D -0.1881
1302 R D 0.0000
1303 T D -0.2346
1304 F D 0.0000
1305 G D 0.0000
1306 Q D -1.1067
1307 G D 0.0000
1308 T D 0.0000
1309 K D -0.1341
1310 V D 0.0000
1311 E D 0.0000
1312 I D -0.3570
1313 K D -0.7580
1314 R D 0.0000
1315 T D -0.1810
1316 V D 0.1161
1317 A D 0.0000
1318 A D -0.1201
1319 P D 0.0000
1320 S D -0.2923
1321 V D 0.0000
1322 F D -0.0307
1323 I D 0.0185
1324 F D 0.0000
1325 P D -0.8323
1326 P D 0.0000
1327 S D -1.8188
1328 D D -3.1823
1329 E D -3.3685
1330 Q D 0.0000
1331 L D 0.0000
1332 K D -3.0381
1333 S D -2.0053
1334 G D -1.4320
1335 T D -1.0941
1336 A D 0.0000
1337 S D 0.0000
1338 V D 0.0000
1339 V D 0.0000
1340 C D 0.0000
1341 L D 0.0000
1342 L D 0.0000
1343 N D -0.3839
1344 N D -0.8104
1345 F D 0.0000
1346 Y D 0.0000
1347 P D -1.3378
1348 R D -2.1611
1349 E D -2.7991
1350 A D -2.1381
1351 K D -2.1653
1352 V D -0.9799
1353 Q D -0.4969
1354 W D 0.0000
1355 K D -0.6134
1356 V D 0.0000
1357 D D -1.9437
1358 N D -1.5249
1359 A D -0.2256
1360 L D 0.8731
1361 Q D -0.0937
1362 S D -0.4640
1363 G D -0.9154
1364 N D -0.8138
1365 S D -1.2446
1366 Q D -1.7463
1367 E D -2.1258
1368 S D -1.1405
1369 V D -0.9786
1370 T D -1.1499
1371 E D -2.2484
1372 Q D -1.8579
1373 D D -2.1231
1374 S D -1.7704
1375 K D -2.3872
1376 D D -1.7595
1377 S D 0.0000
1378 T D 0.0000
1379 Y D 0.0000
1380 S D 0.0000
1381 L D 0.0000
1382 S D 0.0000
1383 S D 0.0000
1384 T D -0.7592
1385 L D 0.0000
1386 T D -0.3904
1387 L D -0.4593
1388 S D -1.1283
1389 K D -2.2062
1390 A D -1.7062
1391 D D -2.1792
1392 Y D 0.0000
1393 E D -3.5845
1394 K D -3.4901
1395 H D -3.0688
1396 K D -3.2298
1397 V D -2.2526
1398 Y D 0.0000
1399 A D -0.8188
1400 C D 0.0000
1401 E D -0.8288
1402 V D 0.0000
1403 T D -1.1645
1404 H D 0.0000
1405 Q D -1.7403
1406 G D -0.5723
1407 L D -0.2433
1408 S D -0.4744
1409 S D -0.6488
1410 P D -0.5485
1411 V D -0.1888
1412 T D -0.5911
1413 K D -0.9082
1414 S D -0.8332
1415 F D -1.0585
1416 N D -2.1975
1417 R D -2.5334
1418 G D -2.2702
1419 E D -2.1641
1420 C D -0.8588

 

Laboratory of Theory of Biopolymers 2015