Project name: 6fa2447ab3607d0

Status: done

submitted: 2017-11-14 21:43:04, status changed: 2017-11-14 21:48:01
Settings
Chain sequence(s) A: MPLGPLWLGLTLLGALQTWAQHPTLVLVPAPALLRVPVQLDFQEEQFQGRWYVLAETENSSKQREPISYYVNTFELLKNHSFRVSSFLKRNNSCDHWIRNLVQQDKPGQFTLDSFRGLGLKRYEMRVVKTDYQRFALVLHTSILATKEGVRASLYARDSQLDPELRGKFLNFIKSLGLTDRHVAFITHDSKRGS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4543
Maximal score value
2.7266
Average score
-0.537
Total score value
-104.1845

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 2.1402
2 P A 2.0751
3 L A 2.2859
4 G A 1.5910
5 P A 1.5511
6 L A 2.6427
7 W A 2.4711
8 L A 2.2036
9 G A 1.6893
10 L A 1.8919
11 T A 1.4115
12 L A 1.4218
13 L A 1.3753
14 G A 0.7795
15 A A 0.0000
16 L A 0.3770
17 Q A -0.6233
18 T A -0.5638
19 W A -0.2176
20 A A -0.4722
21 Q A -1.2349
22 H A -1.2399
23 P A -0.2671
24 T A 0.7110
25 L A 2.2289
26 V A 2.7266
27 L A 1.6567
28 V A 0.7799
29 P A -0.0005
30 A A -0.1939
31 P A -0.0925
32 A A 0.4632
33 L A 1.1934
34 L A 1.3909
35 R A -0.2102
36 V A 0.0000
37 P A 0.1939
38 V A 0.1941
39 Q A -0.2920
40 L A 0.4555
41 D A -1.5433
42 F A 0.0000
43 Q A -2.1880
44 E A -2.2495
45 E A -2.7237
46 Q A -1.9508
47 F A 0.0000
48 Q A -1.7096
49 G A -1.1664
50 R A -1.0713
51 W A 0.0000
52 Y A 0.0000
53 V A 0.0000
54 L A 0.0000
55 A A 0.0000
56 E A 0.0000
57 T A 0.0000
58 E A 0.0000
59 N A 0.0000
60 S A -0.0409
61 S A 0.0000
62 K A -2.2190
63 Q A -3.0316
64 R A -2.8934
65 E A -1.7597
66 P A -0.9130
67 I A -0.5210
68 S A -0.4615
69 Y A 0.0000
70 Y A 0.0000
71 V A 0.0000
72 N A 0.0000
73 T A -0.4395
74 F A 0.0000
75 E A -1.5148
76 L A -1.4808
77 L A -1.2398
78 K A -2.3673
79 N A -2.1665
80 H A -2.0111
81 S A 0.0000
82 F A 0.0000
83 R A -0.5038
84 V A 0.0000
85 S A 0.0000
86 S A 0.0000
87 F A -0.2126
88 L A -0.5570
89 K A 0.0000
90 R A -1.6436
91 N A -2.1778
92 N A -2.1674
93 S A -1.5006
94 C A -0.8819
95 D A -0.9701
96 H A -0.1416
97 W A 0.0000
98 I A 1.2595
99 R A 0.0000
100 N A -0.3908
101 L A 0.0000
102 V A -0.2662
103 Q A -1.3412
104 Q A -1.9020
105 D A -2.8237
106 K A -2.8890
107 P A -1.7921
108 G A 0.0000
109 Q A 0.0000
110 F A 0.0000
111 T A -0.8128
112 L A 0.0000
113 D A -1.4147
114 S A -1.0379
115 F A -1.1103
116 R A -1.7968
117 G A -0.4591
118 L A 1.0090
119 G A -0.1723
120 L A -0.8838
121 K A -2.1590
122 R A -2.5119
123 Y A -1.3201
124 E A -0.7773
125 M A 0.0000
126 R A 0.0000
127 V A 0.0000
128 V A 0.0000
129 K A -0.3616
130 T A 0.0000
131 D A -1.2977
132 Y A -1.0655
133 Q A -1.8461
134 R A -2.0197
135 F A 0.0000
136 A A 0.0000
137 L A 0.0000
138 V A 0.0000
139 L A 0.0000
140 H A 0.0000
141 T A -0.6423
142 S A -1.1069
143 I A 0.0000
144 L A -0.3689
145 A A -0.4464
146 T A -0.5264
147 K A -0.1672
148 E A -1.4431
149 G A 0.0000
150 V A 0.0000
151 R A -0.2667
152 A A 0.0000
153 S A 0.0000
154 L A 0.0000
155 Y A 0.0000
156 A A 0.0000
157 R A -1.7924
158 D A -2.2037
159 S A -1.5759
160 Q A -1.8285
161 L A -1.6312
162 D A -1.6725
163 P A -1.9205
164 E A -2.6649
165 L A 0.0000
166 R A -1.8498
167 G A -1.9773
168 K A -2.3220
169 F A 0.0000
170 L A -1.3289
171 N A -2.2774
172 F A -1.2238
173 I A 0.0000
174 K A -2.1161
175 S A -1.2956
176 L A 0.0000
177 G A -1.2590
178 L A 0.0000
179 T A -2.0997
180 D A -3.1307
181 R A -3.4543
182 H A -2.3403
183 V A -1.4784
184 A A 0.0000
185 F A 0.5024
186 I A 0.0000
187 T A -0.5490
188 H A -1.4366
189 D A -1.4941
190 S A -1.4574
191 K A -1.9346
192 R A -2.1524
193 G A 0.0000
194 S A -1.1432

 

Laboratory of Theory of Biopolymers 2015