Project name: 1JUN

Status: done

submitted: 2017-09-14 09:36:29, status changed: 2017-09-14 09:44:52
Settings
Chain sequence(s) A: CGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY
B: CGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.2558
Maximal score value
1.2724
Average score
-1.9307
Total score value
-166.038

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
273 C A 0.3279
274 G A -0.6791
275 G A -1.3776
276 R A -2.4388
277 I A -2.0225
278 A A -2.2269
279 R A -3.7862
280 L A -2.8720
281 E A -3.6169
282 E A -4.1471
283 K A -3.3585
284 V A -3.4788
285 K A -3.7851
286 T A -2.4874
287 L A 0.0000
288 K A -3.4382
289 A A -2.2489
290 Q A -2.4798
291 N A 0.0000
292 S A -1.7012
293 E A -2.4572
294 L A -1.2579
295 A A -1.1810
296 S A -1.1910
297 T A -1.0887
298 A A 0.0000
299 N A -2.1551
300 M A -0.9638
301 L A 0.0000
302 R A -3.4836
303 E A -3.4368
304 Q A -2.5928
305 V A -2.6554
306 A A -2.6279
307 Q A -3.0307
308 L A -2.0266
309 K A -2.6410
310 Q A -2.3168
311 K A -2.0335
312 V A 0.2463
313 M A 0.2831
314 N A -0.2982
315 Y A 1.2724
273 C B 0.3103
274 G B -0.7042
275 G B -1.4139
276 R B -2.4611
277 I B -2.0961
278 A B -2.2927
279 R B -3.8717
280 L B -2.9691
281 E B -3.6581
282 E B -4.2558
283 K B -3.5716
284 V B 0.0000
285 K B -3.8938
286 T B -2.5657
287 L B -3.1084
288 K B -3.5004
289 A B -2.3448
290 Q B -2.5856
291 N B -2.6132
292 S B -1.7703
293 E B -2.5316
294 L B -1.3430
295 A B -1.2209
296 S B -1.2379
297 T B -1.1049
298 A B 0.0000
299 N B -2.1214
300 M B -0.8930
301 L B 0.0000
302 R B -3.4127
303 E B -3.3042
304 Q B -2.3030
305 V B -2.5673
306 A B -2.5520
307 Q B -2.9587
308 L B -1.9903
309 K B -2.6882
310 Q B -2.3593
311 K B -2.0642
312 V B 0.2112
313 M B 0.2584
314 N B -0.3078
315 Y B 1.2723

 

Laboratory of Theory of Biopolymers 2015