Project name: 753ac1834dc7cf9

Status: done

submitted: 2017-11-14 10:15:58, status changed: 2017-11-14 11:04:06
Settings
Chain sequence(s) A: DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIIILMLAGGGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
C: DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIIILMLAGGGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
B: QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
D: QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9429
Maximal score value
2.2086
Average score
-0.7473
Total score value
-996.8843

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -0.9760
2 I A 0.8050
3 V A 0.0000
4 M A -0.1923
5 T A 0.0000
6 Q A -0.8321
7 T A -0.0175
8 P A 0.2733
9 L A 1.1394
10 S A 0.3941
11 L A 0.1790
12 P A -0.4370
13 V A 0.0000
14 T A -1.5660
15 P A -1.7881
16 G A -1.9628
17 E A -2.0884
18 P A -1.8128
19 A A -1.1815
20 S A -0.8738
21 I A 0.0000
22 S A -1.2727
23 C A 0.0000
24 R A -2.5178
25 S A 0.0000
26 S A -1.2964
27 K A -2.0020
28 S A -1.0387
29 L A 0.0000
30 L A 0.6285
31 H A -0.5594
32 S A -0.7618
33 N A -1.2799
34 G A -0.1502
35 I A 0.9473
36 T A 0.0000
37 Y A 0.7706
38 L A 0.0000
39 Y A 0.0000
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A -0.7176
44 K A -1.1110
45 P A -0.9837
46 G A -1.1021
47 Q A -1.4640
48 S A -1.0755
49 P A 0.0000
50 Q A -0.6790
51 L A -0.0081
52 L A 0.0000
53 I A 0.0000
54 I A 0.0000
55 I A 1.9502
56 L A 2.1447
57 M A 1.9980
58 L A 2.2086
59 A A 0.7243
60 G A 0.2221
61 G A -0.4127
62 G A -0.7485
63 V A -0.3883
64 P A -1.0561
65 D A -1.9360
66 R A -1.7716
67 F A 0.0000
68 S A -0.4238
69 G A 0.0000
70 S A 0.1067
71 G A -0.4824
72 S A -0.3044
73 G A -0.7461
74 T A -1.8440
75 D A -2.7049
76 F A 0.0000
77 T A -0.9932
78 L A 0.0000
79 K A -1.5218
80 I A 0.0000
81 S A -2.1391
82 R A -2.9109
83 V A 0.0000
84 E A -2.1420
85 A A -1.7126
86 E A -2.1468
87 D A 0.0000
88 V A -0.9462
89 G A 0.0000
90 V A -0.1226
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 A A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 L A -0.4979
98 E A -1.5281
99 L A -0.4756
100 P A -0.3442
101 Y A -0.1481
102 T A 0.1733
103 F A 0.3177
104 G A 0.0000
105 G A -0.3764
106 G A -0.4456
107 T A 0.0000
108 K A -0.3015
109 V A 0.0000
110 E A -0.7399
111 I A 0.0000
112 K A -1.2949
113 R A -1.4770
114 T A -0.0166
115 V A 1.0641
116 A A 0.3920
117 A A 0.1160
118 P A -0.0616
119 S A -0.2209
120 V A 0.0132
121 F A 0.1578
122 I A 0.0000
123 F A 0.0000
124 P A 0.0000
125 P A 0.0000
126 S A -1.6161
127 D A -2.9595
128 E A -2.8313
129 Q A 0.0000
130 L A 0.0000
131 K A -3.0459
132 S A -1.7250
133 G A -1.1344
134 T A -0.7403
135 A A 0.0000
136 S A 0.0000
137 V A 0.0000
138 V A 0.0000
139 C A 0.0000
140 L A 0.0000
141 L A 0.0000
142 N A 0.0000
143 N A -0.8923
144 F A 0.0000
145 Y A 0.0000
146 P A -1.7031
147 R A -3.1974
148 E A -3.3140
149 A A -2.5158
150 K A -2.5212
151 V A -1.3222
152 Q A -1.0549
153 W A 0.0000
154 K A -0.3730
155 V A -0.7034
156 D A -1.5090
157 N A -1.2354
158 A A -0.2248
159 L A 0.4771
160 Q A -0.9290
161 S A -0.7731
162 G A -1.2654
163 N A -2.0180
164 S A -1.6074
165 Q A -1.4595
166 E A -1.9032
167 S A 0.0000
168 V A -0.7821
169 T A -1.1309
170 E A -2.2943
171 Q A 0.0000
172 D A -2.5602
173 S A -2.3599
174 K A -2.6866
175 D A -2.7426
176 S A 0.0000
177 T A 0.0000
178 Y A 0.0000
179 S A 0.0000
180 L A -0.6648
181 S A 0.0000
182 S A 0.0000
183 T A -0.7532
184 L A 0.0000
185 T A -0.4934
186 L A -0.5016
187 S A -0.8731
188 K A -1.4753
189 A A -1.5627
190 D A -2.0152
191 Y A 0.0000
192 E A -2.6170
193 K A -3.1297
194 H A -2.7512
195 K A -2.8459
196 V A -1.3874
197 Y A 0.0000
198 A A -0.8856
199 C A 0.0000
200 E A -1.0126
201 V A 0.0000
202 T A -1.1721
203 H A 0.0000
204 Q A -1.8054
205 G A -0.4373
206 L A -0.1566
207 S A -0.4413
208 S A -0.3387
209 P A -0.4613
210 V A 0.0375
211 T A -0.5005
212 K A -0.9084
213 S A -0.7331
214 F A 0.0000
215 N A -1.9008
216 R A -2.1040
217 G A -1.5373
218 E A -1.8221
219 C A -1.5830
220 Q B -1.2398
221 V B -0.3864
222 Q B -1.2824
223 L B 0.0000
224 V B -0.5188
225 Q B -0.5392
226 S B -0.9117
227 G B -0.9943
228 A B 0.0000
229 E B -1.4080
230 V B -0.9308
231 K B -1.5936
232 K B -2.2969
233 P B -2.0748
234 G B -1.6269
235 S B -1.1622
236 S B -1.2497
237 V B -1.3453
238 K B -1.9625
239 V B 0.0000
240 S B -1.0039
241 C B 0.0000
242 K B -1.4619
243 A B 0.0000
244 S B -0.8319
245 G B -0.5786
246 Y B 0.1897
247 A B 0.3900
248 F B 0.0000
249 S B -0.0277
250 Y B 1.2605
251 S B 0.0000
252 W B 0.6623
253 I B 0.0000
254 N B 0.0000
255 W B 0.0000
256 V B 0.0000
257 R B -0.3522
258 Q B -0.7057
259 A B -0.9286
260 P B -0.9275
261 G B -1.2494
262 Q B -1.7953
263 G B -1.0970
264 L B 0.0000
265 E B -0.6456
266 W B 0.0000
267 M B 0.0000
268 G B -0.4869
269 R B 0.0000
270 I B 0.0000
271 F B -0.4738
272 P B -0.3558
273 G B -1.2812
274 D B -2.1773
275 G B -2.0057
276 D B -2.3549
277 T B -1.3204
278 D B -1.0577
279 Y B -1.2298
280 N B -1.6635
281 G B -2.3633
282 K B -3.2606
283 F B 0.0000
284 K B -3.3143
285 G B -2.5011
286 R B -3.3243
287 V B 0.0000
288 T B -1.3426
289 I B 0.0000
290 T B -0.5676
291 A B -0.9449
292 D B -1.7485
293 K B -1.6623
294 S B -1.0365
295 T B -1.0014
296 S B -1.1482
297 T B 0.0000
298 A B 0.0000
299 Y B -0.7841
300 M B 0.0000
301 E B -1.8560
302 L B 0.0000
303 S B -1.6531
304 S B -1.6044
305 L B 0.0000
306 R B -3.3618
307 S B -2.4458
308 E B -2.7953
309 D B 0.0000
310 T B -0.9312
311 A B 0.0000
312 V B 0.3250
313 Y B 0.0000
314 Y B 0.0000
315 C B 0.0000
316 A B 0.0000
317 R B 0.5265
318 N B 1.0438
319 V B 2.0472
320 F B 1.4766
321 D B 0.0000
322 G B 0.1711
323 Y B 0.0000
324 W B 0.0000
325 L B 0.0000
326 V B 0.8822
327 Y B 0.5481
328 W B 0.0000
329 G B 0.0000
330 Q B -1.1987
331 G B -0.4300
332 T B -0.0465
333 L B 0.6379
334 V B 0.0000
335 T B -0.7004
336 V B 0.0000
337 S B -1.3186
338 S B -1.0109
339 A B -0.8061
340 S B -1.0030
341 T B -1.1852
342 K B -2.1043
343 G B -1.7231
344 P B -0.8748
345 S B -0.5974
346 V B 0.0000
347 F B -0.6755
348 P B -1.2700
349 L B 0.0000
350 A B -0.7962
351 P B -0.6756
352 S B -1.0513
353 S B -1.3575
354 K B -1.8431
355 S B -1.3792
356 T B -0.9789
357 S B -0.9935
358 G B -0.9111
359 G B -0.9421
360 T B -0.6638
361 A B 0.0000
362 A B 0.0000
363 L B 0.0000
364 G B 0.0000
365 C B 0.0000
366 L B 0.0000
367 V B 0.0000
368 K B -0.4456
369 D B -0.8904
370 Y B 0.0000
371 F B 0.0000
372 P B 0.0000
373 E B -0.8719
374 P B -0.7424
375 V B -0.5489
376 T B -0.5388
377 V B -0.1314
378 S B -0.4026
379 W B 0.0000
380 N B -1.0958
381 S B -0.7800
382 G B -0.4342
383 A B -0.2102
384 L B 0.0015
385 T B -0.1051
386 S B -0.1029
387 G B -0.1590
388 V B 0.3299
389 H B -0.1128
390 T B 0.0485
391 F B 0.0000
392 P B -0.2576
393 A B 0.3024
394 V B 0.5451
395 L B 1.0837
396 Q B -0.5474
397 S B -0.3949
398 S B -0.4812
399 G B 0.0000
400 L B -0.2091
401 Y B 0.0660
402 S B -0.0256
403 L B 0.0000
404 S B 0.0000
405 S B 0.0000
406 V B 0.0000
407 V B 0.0000
408 T B -0.1036
409 V B 0.0000
410 P B -0.6668
411 S B -0.7069
412 S B -0.7507
413 S B -0.8412
414 L B 0.0000
415 G B -1.2608
416 T B -0.9732
417 Q B -1.4447
418 T B -1.5083
419 Y B 0.0000
420 I B 0.0000
421 C B 0.0000
422 N B -1.6449
423 V B 0.0000
424 N B -1.9055
425 H B 0.0000
426 K B -2.7152
427 P B -1.9596
428 S B -2.0027
429 N B -2.5187
430 T B -2.0993
431 K B -2.6204
432 V B -1.7471
433 D B -2.6647
434 K B -2.1741
435 K B -2.8557
436 V B 0.0000
437 E B -2.7605
438 P B -1.8534
439 K B -1.8759
440 S B -1.4548
441 C B -1.4555
442 D B -1.7533
443 K B -2.2990
444 T B -2.0859
445 H B -2.0024
446 T B -1.5464
447 C B 0.0000
448 P B 0.0000
449 P B -0.1867
450 C B 0.1986
451 P B -0.2513
452 A B -0.2317
453 P B -0.7238
454 E B -1.0142
455 L B 0.5443
456 L B 1.2750
457 G B 0.0596
458 G B -0.2690
459 P B 0.0000
460 S B -0.1322
461 V B 0.0000
462 F B 1.0785
463 L B 0.0000
464 F B 1.4469
465 P B 0.1546
466 P B 0.0000
467 K B -1.9624
468 P B -1.3565
469 K B -1.2918
470 D B 0.0000
471 T B 0.0000
472 L B 0.0000
473 M B 0.6059
474 I B 1.6829
475 S B 0.1896
476 R B -0.8276
477 T B -0.2132
478 P B 0.0000
479 E B -0.5847
480 V B 0.0000
481 T B 0.7994
482 C B 0.0000
483 V B 0.4199
484 V B 0.0000
485 V B -0.6507
486 D B -1.4585
487 V B 0.0000
488 S B -2.0327
489 H B -2.2962
490 E B -2.8113
491 D B -2.4245
492 P B -2.2114
493 E B -2.2638
494 V B 0.0000
495 K B -2.3521
496 F B 0.0000
497 N B -1.7497
498 W B 0.0000
499 Y B -1.1604
500 V B -0.6041
501 D B -1.4167
502 G B -0.5254
503 V B 0.7817
504 E B -0.8625
505 V B 0.0616
506 H B -1.3102
507 N B -1.2018
508 A B -1.0724
509 K B -2.0756
510 T B -1.3929
511 K B -2.0690
512 P B -1.9356
513 R B -3.0735
514 E B -3.7413
515 E B -3.5611
516 Q B -2.7700
517 Y B -1.5534
518 N B -1.4868
519 S B -1.3910
520 T B -1.7842
521 Y B -2.5494
522 R B -2.2237
523 V B 0.0000
524 V B -0.7523
525 S B 0.0000
526 V B 0.1613
527 L B 0.0000
528 T B -0.1421
529 V B 0.4713
530 L B 1.0548
531 H B 0.0000
532 Q B -1.1423
533 D B -1.1022
534 W B 0.0000
535 L B -0.8937
536 N B -1.9994
537 G B -2.0230
538 K B -2.0043
539 E B -2.0487
540 Y B 0.0000
541 K B -1.8389
542 C B 0.0000
543 K B -1.9969
544 V B 0.0000
545 S B -1.4727
546 N B -1.7974
547 K B -2.1557
548 A B -1.3415
549 L B 0.0000
550 P B -0.5067
551 A B -0.4164
552 P B -0.5962
553 I B -0.5631
554 E B -1.6341
555 K B -1.4939
556 T B -1.1267
557 I B -0.0819
558 S B -1.4546
559 K B -1.4117
560 A B -1.3198
561 K B -2.3715
562 G B -2.1208
563 Q B -2.1863
564 P B -2.2771
565 R B -2.7164
566 E B -2.7797
567 P B 0.0000
568 Q B -1.2734
569 V B 0.0000
570 Y B 0.0000
571 T B -0.6801
572 L B -0.3018
573 P B -0.2620
574 P B -0.6080
575 S B -1.2095
576 R B -2.3314
577 D B -2.4920
578 E B 0.0000
579 L B -0.4201
580 T B -0.9604
581 K B -2.0040
582 N B -2.4093
583 Q B -2.3844
584 V B 0.0000
585 S B 0.0000
586 L B 0.0000
587 T B 0.0000
588 C B 0.0000
589 L B 0.0000
590 V B 0.0000
591 K B 0.0000
592 G B -0.9773
593 F B 0.0000
594 Y B -1.3208
595 P B 0.0000
596 S B 0.0111
597 D B -0.8376
598 I B 0.0000
599 A B -0.7512
600 V B 0.0000
601 E B -1.8436
602 W B 0.0000
603 E B -2.1403
604 S B -1.8261
605 N B -2.1314
606 G B -1.7777
607 Q B -2.1391
608 P B -2.0083
609 E B -2.0665
610 N B -2.0029
611 N B -1.5010
612 Y B -0.9873
613 K B -0.5216
614 T B -0.3670
615 T B 0.0000
616 P B 0.0478
617 P B 0.2912
618 V B 0.7486
619 L B 0.8620
620 D B -0.3589
621 S B -1.2649
622 D B -1.9481
623 G B -0.8548
624 S B 0.0000
625 F B 0.1976
626 F B 0.0000
627 L B 0.0000
628 Y B 0.0000
629 S B 0.0000
630 K B 0.0000
631 L B 0.0000
632 T B -0.8375
633 V B 0.0000
634 D B -2.3133
635 K B -2.1248
636 S B -2.1357
637 R B -2.5572
638 W B -1.9929
639 Q B -2.4870
640 Q B -2.5115
641 G B -1.8098
642 N B -1.7077
643 V B -0.9707
644 F B 0.0000
645 S B -1.3529
646 C B 0.0000
647 S B -1.1534
648 V B 0.0000
649 M B 0.0000
650 H B 0.0000
651 E B -1.1915
652 A B -1.9207
653 L B 0.0000
654 H B -1.8819
655 N B -1.7871
656 H B -1.3709
657 Y B -0.8235
658 T B -1.2066
659 Q B -1.5553
660 K B -1.2060
661 S B -0.7132
662 L B 0.0000
663 S B -0.7188
664 L B 0.0000
665 S B -0.9066
666 P B -0.7901
667 G B -1.1687
668 D C -1.1483
669 I C 0.5225
670 V C 0.0000
671 M C -0.1998
672 T C 0.0000
673 Q C -1.3223
674 T C -0.4182
675 P C -0.1567
676 L C 0.8176
677 S C -0.1520
678 L C -0.2198
679 P C -0.6308
680 V C 0.0000
681 T C -1.8550
682 P C -2.0716
683 G C -1.9978
684 E C -1.8169
685 P C -1.5063
686 A C 0.0000
687 S C -0.6289
688 I C 0.0000
689 S C -1.2309
690 C C 0.0000
691 R C -2.3912
692 S C 0.0000
693 S C -1.2269
694 K C -2.0940
695 S C -1.4067
696 L C 0.0000
697 L C 0.0000
698 H C 0.0000
699 S C 0.2265
700 N C -1.0410
701 G C -0.7542
702 I C -0.1865
703 T C 0.0000
704 Y C 0.3879
705 L C 0.0000
706 Y C 0.0000
707 W C 0.0000
708 Y C 0.0000
709 L C 0.0000
710 Q C -0.9121
711 K C -1.2956
712 P C -1.2181
713 G C -1.5502
714 Q C -1.9734
715 S C -1.3406
716 P C 0.0000
717 Q C -0.6340
718 L C 0.1496
719 L C 0.0000
720 I C 0.0000
721 I C 1.6644
722 I C 1.4386
723 L C 1.1349
724 M C 1.5669
725 L C 1.8902
726 A C 0.5998
727 G C 0.0000
728 G C -0.4275
729 G C -0.7575
730 V C -0.4441
731 P C -1.0658
732 D C -1.9444
733 R C -1.6666
734 F C 0.0000
735 S C -0.3243
736 G C 0.4137
737 S C 0.0663
738 G C -0.5361
739 S C -0.8438
740 G C -1.2781
741 T C -1.7284
742 D C -2.2207
743 F C 0.0000
744 T C -0.8850
745 L C 0.0000
746 K C -0.9143
747 I C 0.0000
748 S C -1.9563
749 R C -2.8394
750 V C 0.0000
751 E C -2.4542
752 A C -1.7767
753 E C -2.0381
754 D C 0.0000
755 V C -1.0412
756 G C 0.0000
757 V C -0.6378
758 Y C 0.0000
759 Y C 0.0000
760 C C 0.0000
761 A C 0.0000
762 Q C 0.0000
763 N C 0.0000
764 L C -0.5594
765 E C -1.5896
766 L C -0.8210
767 P C -0.6424
768 Y C 0.0000
769 T C -0.0506
770 F C 0.1579
771 G C 0.0000
772 G C -0.5884
773 G C -0.7208
774 T C 0.0000
775 K C -1.3264
776 V C 0.0000
777 E C -1.1125
778 I C 0.0000
779 K C -1.9511
780 R C -2.2833
781 T C -0.5846
782 V C 0.5181
783 A C 0.1266
784 A C 0.0318
785 P C -0.2168
786 S C -0.2979
787 V C 0.0000
788 F C 0.1847
789 I C 0.0000
790 F C 0.0000
791 P C -0.5946
792 P C 0.0000
793 S C 0.0000
794 D C -3.0847
795 E C -3.1600
796 Q C 0.0000
797 L C -2.5019
798 K C -2.9669
799 S C -1.8694
800 G C -1.4980
801 T C -1.1589
802 A C 0.0000
803 S C 0.0000
804 V C 0.0000
805 V C 0.0000
806 C C 0.0000
807 L C 0.0000
808 L C 0.0000
809 N C 0.0000
810 N C -1.0455
811 F C 0.0000
812 Y C 0.0000
813 P C 0.0000
814 R C -3.2550
815 E C -3.2972
816 A C -2.5205
817 K C -2.5234
818 V C -1.3303
819 Q C -0.9840
820 W C 0.0000
821 K C -0.3994
822 V C -0.7046
823 D C -1.4687
824 N C -1.2713
825 A C -0.2427
826 L C 0.4731
827 Q C -0.9211
828 S C -0.7505
829 G C -1.2487
830 N C -1.9895
831 S C -1.5587
832 Q C -1.3003
833 E C -1.8007
834 S C -0.6077
835 V C -0.7961
836 T C -1.1231
837 E C -2.3531
838 Q C -2.2171
839 D C -2.2446
840 S C -2.1032
841 K C -2.4113
842 D C -2.2862
843 S C -2.2994
844 T C 0.0000
845 Y C 0.0000
846 S C 0.0000
847 L C -0.7228
848 S C 0.0000
849 S C 0.0000
850 T C 0.0000
851 L C 0.0000
852 T C -0.6375
853 L C -0.7750
854 S C -1.5467
855 K C -2.9067
856 A C -2.4701
857 D C -2.8153
858 Y C 0.0000
859 E C -3.9429
860 K C -3.7084
861 H C -3.1106
862 K C -3.1914
863 V C -1.3037
864 Y C 0.0000
865 A C -0.7823
866 C C 0.0000
867 E C -1.0206
868 V C 0.0000
869 T C -1.1712
870 H C 0.0000
871 Q C -1.7880
872 G C -0.4469
873 L C -0.0350
874 S C -0.3969
875 S C -0.3249
876 P C -0.4848
877 V C -0.0328
878 T C -0.5070
879 K C -0.8137
880 S C -0.6729
881 F C 0.0000
882 N C -1.6642
883 R C -2.1297
884 G C -1.6732
885 E C -1.4137
886 C C -0.8278
887 Q D -1.3022
888 V D -0.4227
889 Q D -1.3672
890 L D 0.0000
891 V D -0.5140
892 Q D 0.0000
893 S D -0.9878
894 G D -1.0517
895 A D 0.0000
896 E D -1.5743
897 V D -1.0194
898 K D -1.6484
899 K D -2.3180
900 P D -2.0788
901 G D -1.5795
902 S D -1.1748
903 S D -1.1409
904 V D -1.4454
905 K D -2.0039
906 V D 0.0000
907 S D -1.0190
908 C D 0.0000
909 K D -1.7030
910 A D -1.0743
911 S D -0.8242
912 G D -0.6311
913 Y D 0.1832
914 A D 0.4870
915 F D 0.0000
916 S D 0.1624
917 Y D 1.3601
918 S D 0.0000
919 W D 0.5364
920 I D 0.0000
921 N D 0.0000
922 W D 0.0000
923 V D 0.0000
924 R D 0.0000
925 Q D -0.7329
926 A D -1.0041
927 P D -0.8992
928 G D -1.2414
929 Q D -1.7997
930 G D -1.1787
931 L D 0.0000
932 E D -1.0047
933 W D 0.0000
934 M D 0.0000
935 G D 0.0000
936 R D 0.0000
937 I D 0.0000
938 F D -0.4753
939 P D -0.3467
940 G D -1.3566
941 D D -2.4998
942 G D -2.1286
943 D D -2.2502
944 T D -1.3861
945 D D -1.1462
946 Y D -1.3469
947 N D -1.6361
948 G D -2.1066
949 K D -2.9606
950 F D 0.0000
951 K D -2.8940
952 G D -1.9309
953 R D -2.1782
954 V D 0.0000
955 T D -1.0514
956 I D 0.0000
957 T D -0.4838
958 A D -0.7091
959 D D -1.2607
960 K D -0.8531
961 S D -0.5856
962 T D -0.7227
963 S D -0.8403
964 T D 0.0000
965 A D 0.0000
966 Y D -0.7527
967 M D 0.0000
968 E D -1.6040
969 L D 0.0000
970 S D -1.2303
971 S D -1.1828
972 L D 0.0000
973 R D -3.2275
974 S D -2.4632
975 E D -2.8308
976 D D -1.9362
977 T D -1.0887
978 A D 0.0000
979 V D 0.1771
980 Y D 0.0000
981 Y D 0.0000
982 C D 0.0000
983 A D 0.0000
984 R D 0.4724
985 N D 1.0321
986 V D 1.9692
987 F D 1.8362
988 D D 0.0000
989 G D 0.0000
990 Y D 0.0000
991 W D 0.0000
992 L D 0.0000
993 V D 0.8702
994 Y D 0.3536
995 W D 0.0000
996 G D 0.0000
997 Q D -1.3006
998 G D -0.5214
999 T D -0.2621
1000 L D 0.0563
1001 V D 0.0000
1002 T D -0.8509
1003 V D 0.0000
1004 S D -1.3527
1005 S D -1.0345
1006 A D -0.8018
1007 S D -1.0530
1008 T D -1.0919
1009 K D -2.1053
1010 G D -1.8213
1011 P D -0.8184
1012 S D -0.3839
1013 V D 0.0000
1014 F D -0.8010
1015 P D -1.3951
1016 L D 0.0000
1017 A D 0.0000
1018 P D 0.0000
1019 S D 0.0000
1020 S D -1.1345
1021 K D -1.9340
1022 S D -1.2267
1023 T D -0.9500
1024 S D -0.8744
1025 G D -0.7656
1026 G D -0.6861
1027 T D -0.5227
1028 A D 0.0000
1029 A D 0.0196
1030 L D 0.0000
1031 G D 0.0000
1032 C D 0.0000
1033 L D 0.0000
1034 V D 0.0000
1035 K D -0.3018
1036 D D -0.7635
1037 Y D 0.0000
1038 F D 0.0000
1039 P D 0.0000
1040 E D -0.7537
1041 P D -0.6456
1042 V D -0.4279
1043 T D -0.4947
1044 V D -0.1420
1045 S D -0.4284
1046 W D 0.0000
1047 N D -1.1369
1048 S D -0.8278
1049 G D -0.6151
1050 A D -0.2826
1051 L D -0.0297
1052 T D -0.1369
1053 S D -0.1063
1054 G D -0.0583
1055 V D 0.3285
1056 H D -0.0779
1057 T D 0.0805
1058 F D 0.0000
1059 P D -0.2139
1060 A D 0.2782
1061 V D 0.6345
1062 L D 0.8163
1063 Q D -0.5415
1064 S D -0.3559
1065 S D -0.2756
1066 G D -0.4928
1067 L D -0.0458
1068 Y D 0.1223
1069 S D 0.0000
1070 L D 0.1189
1071 S D 0.0000
1072 S D 0.0000
1073 V D 0.0000
1074 V D 0.0000
1075 T D -0.0665
1076 V D 0.0000
1077 P D -0.5395
1078 S D -0.6194
1079 S D -0.7037
1080 S D -0.8526
1081 L D 0.0000
1082 G D -1.2415
1083 T D -0.9646
1084 Q D -1.4306
1085 T D -1.4142
1086 Y D 0.0000
1087 I D -1.5180
1088 C D 0.0000
1089 N D -1.6490
1090 V D 0.0000
1091 N D -1.6867
1092 H D 0.0000
1093 K D -2.4608
1094 P D -1.7885
1095 S D -1.9856
1096 N D -2.2938
1097 T D -2.0395
1098 K D -2.3947
1099 V D -1.3381
1100 D D -2.6169
1101 K D -2.2935
1102 K D -2.9235
1103 V D 0.0000
1104 E D -2.6662
1105 P D -1.5631
1106 K D -1.2157
1107 S D -1.2281
1108 C D -0.7702
1109 D D -1.6620
1110 K D -1.8933
1111 T D -1.2511
1112 H D -0.8506
1113 T D -1.0860
1114 C D -1.1172
1115 P D -0.7840
1116 P D -0.5811
1117 C D -0.2382
1118 P D -0.3605
1119 A D -0.7481
1120 P D -0.9576
1121 E D -1.4121
1122 L D 0.0887
1123 L D 1.1768
1124 G D 0.0158
1125 G D -0.2155
1126 P D -0.1213
1127 S D 0.0665
1128 V D 0.0000
1129 F D 1.3709
1130 L D 0.0000
1131 F D 1.2104
1132 P D -0.0749
1133 P D 0.0000
1134 K D -1.9781
1135 P D -1.2783
1136 K D -0.9141
1137 D D 0.0000
1138 T D 0.0000
1139 L D 0.0000
1140 M D 0.6862
1141 I D 1.5261
1142 S D 0.0487
1143 R D -1.0296
1144 T D -0.5096
1145 P D 0.0000
1146 E D -0.8998
1147 V D 0.0000
1148 T D 0.6144
1149 C D 0.0000
1150 V D 0.0000
1151 V D 0.0000
1152 V D 0.1485
1153 D D -0.2413
1154 V D 0.0000
1155 S D -1.7026
1156 H D -2.2776
1157 E D -2.7293
1158 D D 0.0000
1159 P D -2.1189
1160 E D -2.3844
1161 V D 0.0000
1162 K D -2.4902
1163 F D 0.0000
1164 N D -1.9390
1165 W D 0.0000
1166 Y D -1.4449
1167 V D -1.0133
1168 D D -2.1551
1169 G D -0.9511
1170 V D 0.3794
1171 E D -1.3299
1172 V D -0.1271
1173 H D -1.3458
1174 N D -1.2335
1175 A D -1.1010
1176 K D -2.0677
1177 T D 0.0000
1178 K D -2.0840
1179 P D -2.0694
1180 R D -2.6888
1181 E D -2.8692
1182 E D -3.0221
1183 Q D -1.8653
1184 Y D -0.6653
1185 N D -0.4756
1186 S D -0.4565
1187 T D 0.0000
1188 Y D 0.0000
1189 R D -1.7475
1190 V D 0.0000
1191 V D -0.7061
1192 S D 0.0000
1193 V D -0.0243
1194 L D 0.0000
1195 T D -0.2489
1196 V D 0.4892
1197 L D 1.1343
1198 H D 0.0000
1199 Q D -0.8825
1200 D D -1.1191
1201 W D -0.8780
1202 L D -0.8983
1203 N D -1.9664
1204 G D -1.9706
1205 K D -2.1004
1206 E D -2.1022
1207 Y D 0.0000
1208 K D -1.7424
1209 C D 0.0000
1210 K D -1.8802
1211 V D 0.0000
1212 S D -1.4473
1213 N D -1.7495
1214 K D -2.0671
1215 A D -1.2438
1216 L D -0.5648
1217 P D -0.4682
1218 A D -0.3138
1219 P D -0.4757
1220 I D -0.2029
1221 E D -1.2489
1222 K D -0.7768
1223 T D -0.9413
1224 I D -0.0399
1225 S D -1.5099
1226 K D -1.6587
1227 A D -1.4415
1228 K D -2.4040
1229 G D -2.1647
1230 Q D -2.2179
1231 P D -2.3575
1232 R D -3.0000
1233 E D -2.7150
1234 P D 0.0000
1235 Q D -1.3557
1236 V D 0.0000
1237 Y D 0.0000
1238 T D -0.6788
1239 L D 0.0000
1240 P D -0.3949
1241 P D 0.0000
1242 S D -1.3701
1243 R D -2.5852
1244 D D -2.7042
1245 E D 0.0000
1246 L D -1.3043
1247 T D -1.3186
1248 K D -2.0966
1249 N D -2.5092
1250 Q D -2.4347
1251 V D 0.0000
1252 S D 0.0000
1253 L D 0.0000
1254 T D 0.0000
1255 C D 0.0000
1256 L D 0.0000
1257 V D 0.0000
1258 K D 0.0000
1259 G D -1.0514
1260 F D 0.0000
1261 Y D -1.4032
1262 P D 0.0000
1263 S D -0.0203
1264 D D -1.0053
1265 I D 0.0000
1266 A D -0.3195
1267 V D -0.1969
1268 E D -0.8546
1269 W D 0.0000
1270 E D -1.7340
1271 S D 0.0000
1272 N D -2.0651
1273 G D -1.8463
1274 Q D -2.2043
1275 P D -1.9499
1276 E D -2.1603
1277 N D -1.9889
1278 N D -1.5175
1279 Y D -0.8855
1280 K D -0.6000
1281 T D -0.3185
1282 T D 0.0000
1283 P D 0.0378
1284 P D 0.3450
1285 V D 0.9681
1286 L D 1.1611
1287 D D -0.2464
1288 S D -1.2302
1289 D D -1.9769
1290 G D -0.8823
1291 S D -0.7205
1292 F D 0.2444
1293 F D 0.0000
1294 L D 0.0000
1295 Y D 0.0000
1296 S D 0.0000
1297 K D 0.0000
1298 L D 0.0000
1299 T D -0.9353
1300 V D 0.0000
1301 D D -2.4920
1302 K D -2.3674
1303 S D -1.9977
1304 R D -2.1133
1305 W D 0.0000
1306 Q D -2.4441
1307 Q D -2.3672
1308 G D -1.3153
1309 N D -1.2380
1310 V D -0.3958
1311 F D 0.0000
1312 S D -0.8909
1313 C D 0.0000
1314 S D -0.3480
1315 V D 0.0000
1316 M D -0.2515
1317 H D 0.0000
1318 E D -1.2471
1319 A D -1.9033
1320 L D 0.0000
1321 H D -1.6050
1322 N D -1.5244
1323 H D -0.8696
1324 Y D 0.1302
1325 T D -0.5023
1326 Q D -0.6831
1327 K D -0.8300
1328 S D -0.2610
1329 L D 0.0000
1330 S D 0.2229
1331 L D 1.2327
1332 S D 0.3277
1333 P D -0.4893
1334 G D -0.6112

 

Laboratory of Theory of Biopolymers 2015