Project name: test_GPF_RAD [mutate: GA10N, VA11R]

Status: done

submitted: 2018-01-12 15:47:12, status changed: 2018-01-12 16:08:31
Settings
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSSSGEGEGDATYGKLTTLKFIICTTGKLPVPWPTLVTTLVQCFSRYPDHMKKQHDFFKSAMPEGYVQERTIFFKKDDGNYKKTRAEVKFEGDDTLVNRIEELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNNFKIRHNIEEDGSVQLADHYQQQNTTPIGDDGPVLLPDDNHYLSTQSALSKDPNEKRDHMVLLEEFVTAAGIT
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GA10N, VA11R
Energy difference between WT (input) and mutated protein (by FoldX) -0.525538 kcal/mol
Show buried residues

Minimal score value
-3.9524
Maximal score value
0.6424
Average score
-0.999
Total score value
-224.7861

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 K A -2.6640
4 G A 0.0000
5 E A -3.1121
6 E A -3.0523
7 L A -1.8524
8 F A 0.0000
9 T A -1.6645
10 N A -2.2239 mutated: GA10N
11 R A -2.6557 mutated: VA11R
12 V A 0.0000
13 P A -1.7135
14 I A 0.0000
15 L A -1.0252
16 V A 0.0000
17 E A -2.0455
18 L A 0.0000
19 D A -3.4683
20 G A 0.0000
21 D A -2.8892
22 V A 0.0000
23 N A -2.1875
24 G A -1.7657
25 H A -2.1533
26 K A -3.0061
27 F A 0.0000
28 S A -1.8168
29 V A 0.0000
30 S A -1.0383
31 G A 0.0000
32 E A -2.0606
33 G A -1.6981
34 E A -2.0879
35 G A 0.0000
36 D A 0.0000
37 A A 0.0000
38 T A -0.3281
39 Y A 0.6424
40 G A 0.0000
41 K A -0.4835
42 L A 0.0000
43 T A -0.5296
44 L A 0.0000
45 K A -0.9019
46 F A 0.0000
47 I A -1.0937
48 C A 0.0000
49 T A -0.9708
50 T A -1.3453
51 G A -1.6857
52 K A -2.2866
53 L A 0.0000
54 P A -1.2574
55 V A 0.0000
56 P A 0.0000
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0037
63 T A 0.0000
64 L A 0.0000
68 V A -0.0390
69 Q A -0.1845
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -0.9936
74 Y A -1.4404
75 P A -1.8981
76 D A -3.0188
77 H A -2.4341
78 M A 0.0000
79 K A -3.1987
80 Q A -2.4023
81 H A -1.5880
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -1.3862
87 A A 0.0000
88 M A 0.0000
89 P A -1.7753
90 E A -2.3517
91 G A 0.0000
92 Y A 0.0000
93 V A 0.0000
94 Q A 0.0000
95 E A -1.8304
96 R A 0.0000
97 T A -0.3199
98 I A 0.0000
99 F A 0.3165
100 F A 0.0000
101 K A -1.7859
102 D A -2.8380
103 D A -2.4368
104 G A 0.0000
105 N A -0.7860
106 Y A 0.0000
107 K A -1.7943
108 T A 0.0000
109 R A -2.8120
110 A A 0.0000
111 E A -2.1218
112 V A 0.0000
113 K A -1.6506
114 F A -1.8101
115 E A -2.5896
116 G A -2.1723
117 D A -2.3734
118 T A -1.6489
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -2.9806
123 I A 0.0000
124 E A -3.9384
125 L A 0.0000
126 K A -2.8465
127 G A 0.0000
128 I A -1.2344
129 D A -2.5078
130 F A 0.0000
131 K A -3.9305
132 E A -3.9524
133 D A -3.5118
134 G A -2.7638
135 N A -2.1270
136 I A 0.0000
137 L A -1.9230
138 G A -2.1807
139 H A -1.9647
140 K A -2.2563
141 L A -1.5287
142 E A -1.5707
143 Y A -0.4851
144 N A -0.5342
145 Y A -0.8623
146 N A -1.2859
147 S A -1.2699
148 H A 0.0000
149 N A -1.2204
150 V A 0.0000
151 Y A 0.5020
152 I A 0.0000
153 M A -0.7753
154 A A -1.5282
155 D A 0.0000
156 K A -3.0544
157 Q A -2.9599
158 K A -3.0016
159 N A -2.8408
160 G A 0.0000
161 I A 0.0000
162 K A -1.0047
163 V A 0.0000
164 N A -0.2812
165 F A 0.0000
166 K A -1.8525
167 I A 0.0000
168 R A -1.6912
169 H A 0.0000
170 N A -1.4810
171 I A 0.0000
172 E A -3.2064
173 D A -3.0091
174 G A -1.9075
175 S A -1.0378
176 V A -0.3751
177 Q A 0.0000
178 L A -1.0128
179 A A 0.0000
180 D A 0.0000
181 H A 0.0000
182 Y A 0.6038
183 Q A 0.0000
184 Q A -0.8512
185 N A 0.0000
186 T A -1.0728
187 P A -0.9599
188 I A -0.4401
189 G A -1.3668
190 D A -2.2584
191 G A -1.5947
192 P A -0.7755
193 V A -0.3124
194 L A -0.2078
195 L A -0.5562
196 P A 0.0000
197 D A -2.3144
198 N A -1.7724
199 H A 0.0000
200 Y A -0.0172
201 L A 0.0000
202 S A -0.5780
203 T A -0.8400
204 Q A -1.3092
205 S A -0.5378
206 A A -0.0056
207 L A -0.0080
208 S A -0.6973
209 K A -1.9664
210 D A -2.1475
211 P A -1.8494
212 N A -2.4849
213 E A -2.7276
214 K A -3.3089
215 R A -3.3832
216 D A -2.2754
217 H A 0.0000
218 M A 0.0000
219 V A -0.2791
220 L A 0.0000
221 L A 0.4245
222 E A -0.0914
223 F A 0.2115
224 V A 0.0000
225 T A -0.3306
226 A A 0.0000
227 A A -0.3687
228 G A -0.4859
229 I A -0.4847
230 T A -0.1849

 

Laboratory of Theory of Biopolymers 2015